(data stored in ACNUC7421 zone)

EMBL: CP000821.PE321

CP000821.PE321       Location/Qualifiers
FT   CDS_pept        complement(374936..375313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0321"
FT                   /product="thioester dehydrase family protein"
FT                   /note="KEGG: shn:Shewana3_0337 thioester dehydrase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34934"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR016962"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ11"
FT                   /protein_id="ABV34934.1"
FT                   /translation="MIKSKLPRVLSTDIQVEAVEWRIFIDADLPFFDGHFPEQAVLPGV
FT                   TQLDWAIRMGCEYFNYPADVATLEVLKFQQLMLPNSEVSLKISQNSSKTKLLFSYFDDE
FT                   KRFASGRILLASPALADIENS"
     atgattaaat ccaagctgcc cagagtcctc tcgacagaca ttcaagtcga agccgtagag        60
     tggcgcatat ttatcgacgc tgacttacca ttttttgacg gccactttcc cgaacaggcc       120
     gtactgccgg gtgtaactca attagactgg gcgattcgta tggggtgtga gtatttcaat       180
     taccctgctg acgttgccac gttagaagtg cttaagtttc agcagttaat gctgccaaac       240
     tctgaggtaa gcctgaaaat ctctcaaaac agcagtaaaa caaaattgct ctttagctat       300
     tttgatgatg agaagcgatt cgcatcgggc cggatcttac tggcctctcc agcccttgct       360
     gatatagaga acagctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page