(data stored in ACNUC7421 zone)

EMBL: CP000821.PE322

CP000821.PE322       Location/Qualifiers
FT   CDS_pept        complement(375306..376670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34935"
FT                   /db_xref="GOA:A8FQ12"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ12"
FT                   /protein_id="ABV34935.1"
FT                   /translation="MTELLKSWLSKGPSSQQLISFNHHDIVNGAAFTSQVTNIHQQLIQ
FT                   SKSQRWLLACESSDLFAVGLCAALLAGKEIILPSNTQTGTLSEITHEFDGVISDQPLCE
FT                   GKTFIMLKRDLHETNNVWPKCDNYGKLVLFTSGSSGHPKAVCKTLEQLDAEVSILENTF
FT                   AKHLPHCSVISTVSHQHIYGLLFKILWPLAASRPFLSDIVEYPETLTYYTSLFPNLCLI
FT                   SSPAQLSRLPESLDNERQLRSPSLVFSSGGPLNFEAAQGIAHCYGRQPIEVFGSTETGG
FT                   VAYRRQTQQDQAWRVFDSIDIRQDDKDGALLLKSPYLENDKWLRCEDKITLLKPGEFQL
FT                   QGRLDRVVKIEEKRLSLVQMEALLESHPLVSQAALLVLDQPRTQLGAVIELSQQGKEQL
FT                   DTEGKLSLNNLFKAHLLTQFERVTLPRRWRYPETVPVNSQGKRLANQLSELFEHD"
     atgacagagt tattgaaatc ttggttatcc aaggggccat cgagccaaca acttatcagc        60
     ttcaatcacc atgatattgt caacggtgcc gcctttacga gccaggttac caatatccac       120
     cagcaactga tccaatcaaa atcacagcgt tggttattgg catgcgaaag tagcgacctg       180
     tttgcagtgg gattatgtgc cgcactgctt gcgggcaaag agataatcct gccatcaaac       240
     actcagactg gcaccttgag tgagataacc catgagttcg atggagtcat ctctgatcag       300
     cctctttgtg aaggtaaaac cttcatcatg ctgaagagag acctccatga aaccaataat       360
     gtctggccaa agtgtgacaa ttacggaaag ctcgttctct ttacttccgg cagtagcggt       420
     catcccaagg ccgtatgtaa aacactcgag cagttagatg ctgaagtcag catccttgag       480
     aacactttcg ccaagcatct tccgcactgc agcgtgatat cgaccgtttc tcatcaacac       540
     atctatggac tgttgtttaa gatcctgtgg ccactcgcgg ccagccgtcc atttttgagc       600
     gatattgtcg aatacccgga aacgctgacc tattacacca gtttattccc caacctttgc       660
     ttgatcagta gcccggctca gttatcccgt cttccggaat cattggataa cgaacgccag       720
     ttaagatcgc caagcctagt attcagctct ggcggaccgc ttaatttcga ggcggcccaa       780
     ggcatcgctc actgttatgg ccgacaaccc atagaggttt tcggcagcac agaaactggc       840
     ggagtagcct accgtagaca gactcaacaa gatcaagcct ggcgcgtttt cgacagcatt       900
     gatatccgcc aagacgataa agatggcgcc ttgctgctta aatcacccta tcttgagaat       960
     gataaatggc tgagatgcga agataagatc actcttctca agcccggtga gtttcagtta      1020
     cagggacgac tcgaccgggt agtaaaaatc gaagagaagc gtctgtcact ggtgcagatg      1080
     gaggccctgt tagagagcca ccccttggtc agtcaggcgg cactgcttgt cttagatcag      1140
     ccacgcacgc aacttggggc cgtcattgag ttatctcagc aaggcaaaga gcagttagat      1200
     accgagggaa agctcagcct taataatctg tttaaggctc atctgttgac ccagttcgaa      1260
     cgagtcaccc tgcccagacg ttggcgctac cctgaaactg ttcccgtgaa ctctcaggga      1320
     aaaagattag ctaatcaatt atctgagttg ttcgaacatg attaa                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page