(data stored in ACNUC7421 zone)

EMBL: CP000821.PE323

CP000821.PE323       Location/Qualifiers
FT   CDS_pept        complement(376667..377215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34936"
FT                   /db_xref="GOA:A8FQ13"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ13"
FT                   /protein_id="ABV34936.1"
FT                   /translation="MRLFLQIVTSLLLIGYPLAVYFGLNYLPAGTIAMVLCLFLILRLL
FT                   IQKQQVKSMVLPVLVGIGLTAGSFIAKRHDWLLYYPVVINLSMLLLFGYSLKSGPSMIE
FT                   RLARLKEPDLPDEAIPYLQKVTLIWCGLFVFNGVVALYTARYSSLEIWTLYNGLIAYLL
FT                   IGSLLGGEWLYRTIWLKKS"
     atgcgcttat ttttacaaat agtcaccagt ctcttattga ttggctatcc tttagccgtt        60
     tattttggac tcaactattt gccggcaggc accatagcca tggtactttg cctgttttta       120
     attctgcggt tgctgataca aaagcaacag gtaaagtcga tggttttgcc tgtattggtc       180
     ggtataggat taactgccgg aagttttatc gcaaagaggc atgattggtt actttactat       240
     ccagtggtga ttaaccttag catgctactt ttgttcggct attcgctaaa atcgggaccg       300
     agtatgattg aacgactcgc caggttgaaa gaacctgatc ttcccgatga agcgatacct       360
     tacttacaaa aagtcacgct catctggtgt ggcttatttg ttttcaatgg cgtcgtagcc       420
     ctctataccg ctcgctattc cagtttggaa atatggacgc tgtataacgg acttatcgcc       480
     tatctgctca taggttcgct acttggtggc gagtggttgt atagaactat ttggttaaaa       540
     aagtcatga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page