(data stored in ACNUC7421 zone)

EMBL: CP000821.PE325

CP000821.PE325       Location/Qualifiers
FT   CDS_pept        complement(377472..377726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0325"
FT                   /product="acyl carrier protein, putative"
FT                   /note="KEGG: shn:Shewana3_0344 acyl carrier protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34938"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ15"
FT                   /protein_id="ABV34938.1"
FT                   /translation="MSLHNEIKQLIIDCLDLEDVSIDDIETDAALFGEGLGLDSIDALE
FT                   LGLAIKKRFDVKIEANSEATKAHFYSVANLASFIESQRA"
     atgagcttac acaacgaaat aaaacaatta atcatagatt gcttagatct tgaagacgtc        60
     agcatcgatg atattgaaac tgatgcggcg ctatttggag aaggcttagg gctggactca       120
     atcgatgcgc tggaactagg cctagcgatt aaaaagcgat tcgatgtgaa aatcgaagcg       180
     aactctgaag ccactaaagc acatttttat agcgtggcca acttggctag ctttattgaa       240
     tcgcagcgag cttag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page