(data stored in ACNUC7421 zone)

EMBL: CP000821.PE327

CP000821.PE327       Location/Qualifiers
FT   CDS_pept        complement(378514..379230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34940"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ17"
FT                   /protein_id="ABV34940.1"
FT                   /translation="MQLLFTICSWGAWSPRCQQASDWKRWPETKLAHDSDLPRAPKLAQ
FT                   VPAMQRRRYSALTKMQLEAAFQCDAPQQCRTIFSSRHGELNRTIGLLDNVVNREALSPT
FT                   AFSQSVHNTASGIYSILKGNRSASTSIAAGSETLYQALVEAYAQLHEDPTPLLFVFGDE
FT                   PVPQVYSQFTDEPELPLSMAFVLTLTAPEPGQPQLTIGNLTSADDLSYGELLHSLATKQ
FT                   PTSGTLSKHHWQLSFG"
     gtgcagttac tatttacaat ttgttcttgg ggagcctggt ctcctcgatg ccaacaggcc        60
     agtgattgga agcgttggcc ggaaacaaaa ttagctcatg attcagatct gcccagagca       120
     ccaaaattag cccaggttcc ggccatgcag cgcaggcgct atagcgctct gaccaagatg       180
     caactcgaag ccgcctttca atgtgatgcg ccgcagcaat gccgtaccat cttcagctcc       240
     agacacggag agctaaatcg caccataggg ctactcgata atgtcgtaaa tcgagaggcc       300
     ctttctccca cggcctttag ccagtcggtc cataataccg ccagtgggat ctacagcata       360
     cttaagggaa accgctccgc ctctacctcg attgccgcag gtagtgagac actttatcaa       420
     gcactggttg aggcttatgc tcagcttcac gaagacccca ctccactcct gtttgtcttt       480
     ggtgatgaac cggttccaca ggtttatagc cagttcaccg acgagccgga actgccgctc       540
     tctatggcct tcgttttgac gcttacagcg cctgagcccg gtcagccaca gctcaccata       600
     ggcaatttaa cttcggcaga tgatctgagt tatggagagc ttctccatag tctggcgaca       660
     aaacagccca cgagtggaac gctatctaaa catcattggc agttaagttt tggataa          717
//

If you have problems or comments...

PBIL Back to PBIL home page