(data stored in ACNUC7421 zone)

EMBL: CP000821.PE328

CP000821.PE328       Location/Qualifiers
FT   CDS_pept        complement(379475..380344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34941"
FT                   /db_xref="GOA:A8FQ18"
FT                   /db_xref="InterPro:IPR021382"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ18"
FT                   /protein_id="ABV34941.1"
FT                   /translation="MQVSQEDRIAPQEKSAGANTIAIVALAVVVLISGGAYYYFSDTAE
FT                   LQPQERAAVEIPDVLPEEPLVTIADIPEPEIEAVVEPVIEVVETPQPEIEPLPTLEESD
FT                   SFVHDKTVVMADGMAIEPMLVEKDLVRHFVVFVDNLAQGELARKVSPLKGPERVFTVSE
FT                   ITNKTYLNPDSYHRYDLYADFVANLNEVQLADTYKELTPLLSEAFEELGYGDMSFNERM
FT                   LEAIDIMLAAPIIEQPIELDGVSVNYQFVDPQLEALPNAQKLLVRMGPENSKKVKAALR
FT                   RLKKHLAD"
     atgcaagtta gtcaagaaga tagaatagca ccgcaagaaa agtctgccgg tgccaatacc        60
     atagcaatcg tggcgcttgc cgttgtggta ctcatctccg gtggagctta ttactatttc       120
     agcgataccg cagagttaca accacaagag agagccgccg ttgaaatacc ggacgtgctc       180
     cccgaagagc ctctcgtcac cattgccgat atcccggagc cagagataga agctgtcgtc       240
     gaaccggtaa tagaggtggt tgagacccct caaccagaaa ttgaacctct gccgacgttg       300
     gaagagagtg atagttttgt tcatgacaag acggtcgtga tggccgacgg tatggcgatt       360
     gagcccatgc tggtcgaaaa agatctcgtg agacattttg tggtgtttgt cgataacctg       420
     gcgcagggag aactcgctcg caaggtcagt ccgctcaagg ggcctgagag agtatttacc       480
     gtttcagaga tcaccaataa aacttacctt aacccggaca gctaccacag gtacgacctt       540
     tacgccgatt ttgttgccaa cttaaatgag gtgcaacttg ctgacaccta taaagagctg       600
     accccgctgt tatctgaggc atttgaggag ttaggttatg gtgatatgag ctttaatgag       660
     cgcatgctgg aggccatcga catcatgctg gcggcgccga ttattgaaca acccatagag       720
     ctcgatggtg tcagcgttaa ctatcaattt gtcgatcctc aacttgaagc ccttcctaat       780
     gcgcaaaaat tattagtgag aatgggccct gaaaatagca agaaggtgaa agctgcgctt       840
     cgtagactaa agaagcatct agctgattaa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page