(data stored in ACNUC7421 zone)

EMBL: CP000821.PE33

CP000821.PE33        Location/Qualifiers
FT   CDS_pept        complement(39506..40786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0033"
FT                   /product="sun protein"
FT                   /note="KEGG: slo:Shew_3738 sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34646"
FT                   /db_xref="GOA:A8FP73"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP73"
FT                   /protein_id="ABV34646.1"
FT                   /translation="MNLRALAAKVVFQVLEKGISLSVALPDQQRHLESGKDKALMAELC
FT                   YGVMRHLPQLDKLVSDCMSKPLKGKQRILHQLLLVGCYQLYFTRIPSHAAISETAEACR
FT                   QLKFEGLVKVVNGVLRNIQRQEKPLPTDNETLALNTPAWIIKRLKAAYPESWKEIVEQS
FT                   HQRPPMWLRSNKLSQTRDEYLASLAEVEIQASAGKSSDAILLESPKDVLQLPGFEEGTA
FT                   SVQDGAAQWAATLLAPIDGELVLDACAAPGGKTCHLLEQAPNIELVAVDFDANRLERVQ
FT                   QNLDRLSLNAKLIHGDAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQADI
FT                   EELASLQSKILDHCWQWLKPGGTLLYATCSILPQENEQQIRAFLERANDATLVPIDEQN
FT                   HPDDIGWQITPGLENMDGFYYARLVKG"
     atgaatttgc gagcattagc ggccaaggtc gtatttcagg tgttggaaaa agggatttca        60
     ttgtctgtcg ccctgccgga tcagcaaaga caccttgaaa gtggtaaaga taaggctcta       120
     atggccgagc tctgctatgg cgtcatgcgc cacctgcctc agcttgataa attggtcagt       180
     gactgcatga gtaaaccact gaagggcaag caaaggatac tgcatcaact gttactcgtt       240
     ggctgctatc aactttattt cacccgcatc ccgagccatg cagccatttc agaaaccgcc       300
     gaagcctgcc gacaactcaa atttgaaggc ctggtaaaag ttgtcaacgg tgtactgcgc       360
     aatattcagc gtcaagagaa gccactgcct acagataacg aaaccttagc tctcaatact       420
     ccggcctgga taatcaagcg actcaaagcg gcttatccgg aaagctggaa agagatcgtt       480
     gagcaaagcc atcaacgtcc acctatgtgg ctacgcagca ataaactgtc gcagactcgc       540
     gatgagtact tagcctctct tgccgaagtt gagatccaag cttctgcagg taagagtagc       600
     gatgccatct tactcgagag tcctaaagat gtattgcaac ttcccggctt tgaggaagga       660
     accgcctcgg ttcaggacgg tgcggctcaa tgggctgcaa ctctactggc cccaatcgat       720
     ggggaattag tcctcgatgc ctgtgcggca ccaggcggta agacttgtca cctattagaa       780
     caagccccca atattgaatt agtcgccgtc gattttgatg ccaaccgtct cgaacgagtc       840
     cagcaaaacc ttgaccgtct gtcgctcaac gcaaaactga tccatggcga tgccgccgat       900
     atcgattcat ggtggcaagg agataagttt gatcgcatcc tactcgatgc cccttgctcg       960
     gcaacaggtg ttatccgtcg tcatcccgat atcaaatggc taagaaaaca agccgatatc      1020
     gaagagttgg cctcactgca gagtaagata ttagatcact gttggcagtg gctcaagccc      1080
     ggtggcacac tgctctacgc gacttgctca atccttcctc aggaaaacga acagcagatc      1140
     cgtgccttcc tggagagagc caatgacgcg actctcgttc caatcgatga gcaaaaccac      1200
     cccgatgata ttggatggca aattacaccg ggattggaga atatggatgg attttactac      1260
     gcacggttgg taaagggata a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page