(data stored in ACNUC7421 zone)

EMBL: CP000821.PE335

CP000821.PE335       Location/Qualifiers
FT   CDS_pept        complement(389159..389443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0335"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="KEGG: slo:Shew_3498 DNA-directed RNA polymerase,
FT                   omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34948"
FT                   /db_xref="GOA:A8FQ25"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ25"
FT                   /protein_id="ABV34948.1"
FT                   /translation="MARVTVEDAVNQIGNRFDMILVAARRARQIAVQGKDPMVEEENDK
FT                   PTVIALREIELGLVTADTLDADERQTVREREAAEIAAVAAIAEGRNNVI"
     atggctcgcg taactgtaga agacgccgta aaccaaatcg gcaaccgttt tgatatgatc        60
     ctggttgcag cgcgtcgtgc tcgccaaatc gctgtgcagg gtaaagaccc tatggttgaa       120
     gaagagaacg acaagcctac ggttatcgct cttcgcgaaa tcgaattagg tttagtcact       180
     gctgacactt tggatgccga tgagcgccaa actgttcgtg aacgtgaagc ggcagaaatt       240
     gctgctgttg ctgcgattgc tgaaggtcgt aacaacgtaa tataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page