(data stored in ACNUC7421 zone)

EMBL: CP000821.PE336

CP000821.PE336       Location/Qualifiers
FT   CDS_pept        complement(389500..390123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0336"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: shm:Shewmr7_0330 guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34949"
FT                   /db_xref="GOA:A8FQ26"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ26"
FT                   /protein_id="ABV34949.1"
FT                   /translation="MTARGNLFIVSAPSGAGKSSLISALLKDKPTDKQVSVSHTTRQPR
FT                   PGEVNGQHYHFVTVEEFKALIEENAFFEWAEVFGNYYGTSRRVIEQTLNEGIDVFLDID
FT                   WQGAQQVKKLMPESIGVFILPPSRAELERRLAGRGQDSNEIIAGRMAQAASEISHYAEY
FT                   DFIIINDDFDTALADLIAIIRSQRLTGAGQIHAQNDMIKDLLAD"
     atgaccgcac gcggaaacct atttatcgta tcggcaccga gtggtgcggg taagtcttca        60
     ctgatatcgg cactattgaa agataaaccg actgacaagc aagtttctgt gtctcatacc       120
     acgcgccagc cgcgccccgg tgaagtgaat ggccaacact accattttgt tactgtcgaa       180
     gagttcaaag cattaattga agaaaacgcg tttttcgagt gggccgaagt gttcggtaac       240
     tactatggca catcgcgcag agttatcgag cagaccctta atgaaggtat cgatgtgttt       300
     ctcgatatcg actggcaagg ggctcagcag gttaagaaat tgatgcctga atccataggg       360
     gtatttattt taccgccttc gagagccgaa ttagaacgcc gcctggcggg tcgaggtcag       420
     gatagcaatg agatcatcgc aggccgtatg gcgcaagccg catcagagat ctcacattat       480
     gctgaatacg acttcatcat tattaacgat gacttcgata ccgccctcgc cgatttaatc       540
     gccattattc gcagccaacg cttaactggt gctggccaaa ttcatgctca aaatgatatg       600
     attaaagatc tgttggcaga ctag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page