(data stored in ACNUC7421 zone)

EMBL: CP000821.PE337

CP000821.PE337       Location/Qualifiers
FT   CDS_pept        390490..391557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34950"
FT                   /db_xref="GOA:A8FQ27"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ27"
FT                   /protein_id="ABV34950.1"
FT                   /translation="MQYRSLFCVRGRDNGPRFALISALAYLILLLGFIFIGASSALIII
FT                   GLFLTPLLGLSGLRRMRDAARPAWLLGLSFIPLLFFVLSLVYGDSLSFSASCVVFATLI
FT                   TGFLAMQRSASKNSHYHQGYSGPAAMTAGGKGRKRVEPTLDGSAAPVGGHISDNMSEQV
FT                   EEPESYEETGRGFDGISLEQWSSWAKQNRRLLLASVGGLSCMILIAGVWSLFSGAAGDE
FT                   DVAQEPEVSAPQIIVKRDEVKLPDGFSLILEHDLLVMRWLGETEEPGTIWSLATAQGDK
FT                   TCAHLIFNNGTRYRPVTVEQMPDTGIEARFSPLDTESIISDIARRGSVKLCGYDFSLKG
FT                   SQSALAKSGSFIPYL"
     atgcagtata gatcgctctt ttgtgtccgg ggacgagata atggtcctag atttgcgctt        60
     atcagtgcgc tggcttacct tattttatta ttagggttca tctttatcgg agccagttcg       120
     gcactgatca tcattggcct gttcttgacg cctctccttg gccttagcgg tctgcgccgt       180
     atgcgcgatg cagccagacc ggcttggttg ctcggtttga gctttattcc tctgctgttt       240
     tttgttctct ctcttgtcta tggcgacagt cttagctttt ctgcaagttg tgtcgtcttt       300
     gccactctta taacaggctt tctggcgatg cagagatcgg cgagtaaaaa cagccattat       360
     catcagggtt attccggacc cgctgccatg accgcaggcg ggaaaggacg taagagggtt       420
     gagccaacct tagacggctc agcggcgcct gttgggggac acatttcaga taacatgtct       480
     gagcaggttg aagagcctga gtcatatgag gaaaccggca gaggtttcga tggtatctca       540
     ttggagcaat ggagctcatg ggctaagcaa aacaggaggc tgcttctggc ctcggttggc       600
     gggctatcat gcatgatact catcgccgga gtgtggtcgc tattttccgg ggcggcaggc       660
     gatgaagatg tcgcacaaga gccggaggta tcggcgcctc agattatcgt caaaagggat       720
     gaagttaagc ttcccgatgg attcagcctg atcctggaac atgatctatt ggtgatgcgc       780
     tggctggggg aaaccgagga gcccggaact atctggtctc tggcaacggc tcagggagac       840
     aaaacctgtg ctcatctgat ttttaataat ggtacgcgtt atcgcccggt aactgtggag       900
     cagatgccgg atacaggcat agaagccagg ttctcaccgc tcgataccga atccattatc       960
     agcgatatcg cacgccgcgg tagcgtgaag ctctgtggct atgattttag cctgaaaggt      1020
     agtcagtctg cgctggcaaa gagtggatct tttatcccct atttatag                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page