(data stored in ACNUC7421 zone)

EMBL: CP000821.PE338

CP000821.PE338       Location/Qualifiers
FT   CDS_pept        391663..392631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34951"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ28"
FT                   /protein_id="ABV34951.1"
FT                   /translation="MTLTAIMNENRPLTLVIMAAGLGSRFGGDKQLAALGPNGETMLEL
FT                   STISAYKAGFTQVVLVIRPELEAQLESLFCERVKPQVSSEFQYHFCYQKIDDLPAEALT
FT                   HFDTFDHRLKPWGTAHALWCTRHKVKGLMAVINADDFYGDTAFELLAQGLRNRPQEWML
FT                   VAYPLHLTLSEHGGVNRGVCRVDQGVLQGVAEWTDIRQEPQGLVGLCDGESGNLKSSTP
FT                   VSMTCWGFSAAIFSVLEDALNQFIVEHGHEQRAECYLPTVIQHHMDSAKLNKQPNNEQE
FT                   ARVIRVETAQEPWFGVTYPQDVAWVQNKLNELVNKKNGVVA"
     atgacgctta cagcaatcat gaatgaaaat agaccgttaa cgctagtcat tatggcggcg        60
     ggactcggta gtcgattcgg tggagataag cagttggccg ccttagggcc aaatggcgaa       120
     accatgttgg aactgtcaac catatcggca tataaggcag gtttcactca ggttgtcctg       180
     gtgataaggc ccgagctcga agcacagctc gagtctctgt tttgtgagcg agtcaaacct       240
     caggtgtcat ctgaattcca ataccatttt tgctatcaaa aaattgatga tctcccggca       300
     gaagcgttaa ctcatttcga tacctttgac cataggctga aaccttgggg tactgcgcat       360
     gcactctggt gtacgcgcca caaagttaaa ggcttaatgg cggtgattaa tgccgacgat       420
     ttttatggtg ataccgcttt cgaactgttg gctcaaggtt tacgaaacag gccgcaagag       480
     tggatgttgg tggcttatcc actgcatcta accctgtctg aacatggcgg agtgaataga       540
     ggcgtgtgtc gggtcgatca aggtgtgctg caaggtgttg ccgagtggac cgatattagg       600
     caagagcccc aaggtttagt gggtttatgt gatggtgagt ctggcaatct gaagtcctct       660
     acacctgtct ctatgacctg ttggggtttc tcagccgcta ttttttctgt cctagaggat       720
     gcactgaatc agtttatagt tgagcatggc catgaacaaa gagcggagtg ctacctgccc       780
     accgtcattc agcatcatat ggattcagca aaacttaata aacaacctaa taatgaacaa       840
     gaagccagag tgatacgggt cgaaacggct caagagccct ggtttggagt gacctaccct       900
     caggatgtag cgtgggtgca aaataagctc aatgagcttg taaataagaa gaatggagtg       960
     gttgcgtga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page