(data stored in ACNUC7421 zone)

EMBL: CP000821.PE340

CP000821.PE340       Location/Qualifiers
FT   CDS_pept        complement(394139..395614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VVA1406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34953"
FT                   /db_xref="GOA:A8FQ30"
FT                   /db_xref="InterPro:IPR021794"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ30"
FT                   /protein_id="ABV34953.1"
FT                   /translation="MSENRQEGSVNSELSYQQAHKPASDFETREAYLNNELIIMRFRRW
FT                   RLHLPFRDFGIEPEDLVPALAATIGKVVMVTAMAAAFAVQFGLTPEFVAENVRYELLIA
FT                   GVLFVILFSALLNPNTNLAGTHGPMIPLIPLIAAAGGHPLALGIMVGLFGLLLSFSKGG
FT                   SKLVKLTGEGVRGGLLIYLGAVGLIGQITKLELWSGSIGQGAVSFGVILATIVIYAYLA
FT                   KIHKRWLAIPLCSLIAGLVAFAMGTPFEFVTEPGLPHFSPSYWWGESTGWQLGWPSISH
FT                   YVAVIPFAILAVAMWSPDFLGHRVFQELNYPKKAEGVLMNVDDTMTVCSIRQIVGSILG
FT                   GGNLASSWGTYMIPAAIAKRPIPGGAVLTGIMCVLAAVIGYPMDLAMWEPVLRVALLVG
FT                   VFLPLLEAGMQMVRDTQDSQAAGICLFSCAFVNPVFGWALTMLLDNMGFIGDKTRSEKL
FT                   SLMDKLIIPLTAFIICVGSLALVGQLPGIPALL"
     atgtcagaga ataggcaaga ggggtccgta aatagcgagt taagctatca acaagcccac        60
     aaacccgcta gtgactttga aacccgcgaa gcatatctca acaatgaatt gatcataatg       120
     aggttcaggc gctggcgact tcatctgcct tttagagatt ttggtattga accagaagat       180
     ttagtaccgg cgctggcagc cactataggt aaagtcgtca tggtgaccgc catggccgcg       240
     gcctttgcgg tgcagtttgg gctaacacct gaatttgttg ctgagaatgt tcgttatgag       300
     cttctgattg ctggtgtgtt atttgtcatt ctattttcag ctttgctcaa cccaaacacc       360
     aaccttgcgg gcacccatgg ccctatgatc ccgctgattc cgctcattgc agcagcaggg       420
     ggccacccgt tagcactggg catcatggta gggcttttcg gtttattgct gagcttcagt       480
     aagggaggct caaagctagt caaactaacg ggggaaggcg ttcgaggggg cttgcttatt       540
     tatcttgggg ctgtaggttt aatcggtcaa atcactaaac tcgagctttg gtctggtagt       600
     atcggtcagg gagccgtgtc ttttggcgtg atactggcaa ccattgttat ctatgcctat       660
     ctcgctaaaa tccataaacg ctggctggcc attccccttt gttcacttat cgccggtctt       720
     gttgccttcg caatgggaac accttttgag tttgtaaccg aacccggcct gccccatttc       780
     agtccaagtt attggtgggg tgaatcgaca ggttggcaat taggttggcc cagcataagc       840
     cattatgtcg ccgttattcc ctttgctatt ttggccgtcg ccatgtggtc acctgacttt       900
     ctaggccaca gggtcttcca agagttgaat taccctaaaa aagccgaagg cgtgttgatg       960
     aatgtggatg acaccatgac tgtgtgctca attcgccaga ttgtcggctc tatcctcggt      1020
     ggcggtaatt tagcctcatc ctggggaacc tatatgatcc cagccgcgat agctaaacgc      1080
     ccgattcccg gcggtgcggt acttacgggc atcatgtgtg tgctggccgc tgtaattggc      1140
     tatccaatgg atctcgccat gtgggagcca gtgctgagag tcgcattgct cgttggcgtt      1200
     ttcttaccgc tacttgaagc cggaatgcag atggttagag atactcagga ttcacaagct      1260
     gcagggattt gtttgttctc atgcgctttt gttaaccctg tttttggttg ggcgttaact      1320
     atgctacttg ataatatggg ttttattggc gacaaaactc gcagtgaaaa gttatcattg      1380
     atggacaagc tgatcattcc actaaccgcc tttattattt gtgtaggctc acttgcactc      1440
     gtcgggcaac ttccggggat tcctgcactg ctgtaa                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page