(data stored in ACNUC7421 zone)

EMBL: CP000821.PE341

CP000821.PE341       Location/Qualifiers
FT   CDS_pept        395907..396092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34954"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ31"
FT                   /protein_id="ABV34954.1"
FT                   /translation="MPPSLVASALDVEVVAHNHRSDIFQPGVLTEMDAFISARETLGGV
FT                   SFSYWGPVSAGADVGQ"
     atgcctccga gcctggttgc gtcggcattg gatgttgaag ttgtagccca caatcatcgt        60
     tcagatatct ttcaacccgg cgtgcttacc gaaatggatg cttttatctc cgctcgtgaa       120
     acgcttggtg gtgtgagctt ctcatattgg ggacctgtat ctgcaggtgc agatgttggc       180
     caataa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page