(data stored in ACNUC7421 zone)

EMBL: CP000821.PE344

CP000821.PE344       Location/Qualifiers
FT   CDS_pept        complement(398611..400170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0344"
FT                   /product="flavocytochrome c flavin subunit, putative"
FT                   /note="KEGG: son:SO3058 flavocytochrome c flavin subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34957"
FT                   /db_xref="GOA:A8FQ34"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ34"
FT                   /protein_id="ABV34957.1"
FT                   /translation="MSDKQPISLRRRQLITGGAALAVTGLGASLAKPVSAACVPAEEVK
FT                   FDEVVDIIVVGSGFAGMSAALQAREAGASVMVVDKMPVFGGNSTINGGAMAVAGSPLQQ
FT                   QNGIKDSVDTMVADMLEAGRGMNDVEMLKLVCNGTAESCQWLTDYGVKWKPFVQHFGGH
FT                   SIPRVLQTVESSGAGIIRPLVKAAKKRGIDMRTQTKLESFIEDDQGRVTGIEVKANYFF
FT                   PKERSGVTRRYGARKGIIMATGGFGRDIEYRKMQQPKLTKELDSTNHPGANADALKQMM
FT                   LIGANPIHLDQIQLGPWASPDEKGFGTASQFNTIATYPRGIVVDARTGKRFFNELADRK
FT                   ARADAIMTRRDAQGQPVYPIGFTNAEGASKAQTLDWGLKYNVIKKADTLEELAKIYGIP
FT                   ADALKAQVESWNKAVDTGEDSEFGRPMQKAMKLEQGPWYAVRMWPKVHYCMGGVKVNTR
FT                   SEVLHLVTYKPIAGLFAAGEATGGIHGASRLGACAVAEGVVTGRNAGQMCAASKSIVLK
FT                   HV"
     atgagtgaca aacaaccaat aagccttcgc agacgtcagc taattaccgg aggagcagca        60
     ctcgccgtta ccggtctggg agcctctctg gctaaacctg tcagtgccgc atgtgtgccg       120
     gccgaagagg tcaagtttga tgaagttgtc gacatcatag tggtaggtag cggttttgcc       180
     ggcatgtcgg cagcattgca ggcccgggaa gccggagcca gcgtaatggt ggtggataag       240
     atgcctgtct tcggtggtaa ctccaccatc aatggcggcg ccatggccgt ggccggctcc       300
     cctctacagc agcaaaacgg tattaaggac tcggtagaca ctatggtggc cgacatgctt       360
     gaagcgggcc gtggcatgaa tgatgtcgag atgctcaagc tggtatgtaa tggcaccgcc       420
     gagtcgtgcc aatggctgac cgattatggc gttaagtgga aaccctttgt gcagcacttt       480
     ggtggtcact ctattccacg tgtgcttcaa acagtcgaaa gctcgggggc cggtatcatt       540
     cgccctctgg tcaaggcagc caagaaacgc ggcatagata tgcgcaccca gaccaagctg       600
     gagtctttta ttgaggatga ccagggacgc gtaacgggta tcgaagttaa ggccaactac       660
     ttcttcccta aagagcgctc cggtgtgact cgccgttacg gtgcccgcaa ggggatcatc       720
     atggccaccg gcggcttcgg tcgtgacatc gaatatcgca agatgcagca acctaaactc       780
     accaaagagt tggattccac taaccatccg ggcgccaatg ccgatgcgct gaagcagatg       840
     atgctgatcg gcgccaaccc catccacctg gatcaaattc agctgggccc atgggcctct       900
     ccagatgaga aaggttttgg caccgcatca caatttaaca ccatcgcgac ctaccccaga       960
     ggcatagtgg tcgatgcacg taccggtaag cgtttcttta acgaactggc cgatcgtaag      1020
     gcccgcgccg acgccatcat gacccgtcgt gacgcccagg gacaaccagt ttatcccatc      1080
     ggctttacca atgccgaagg cgccagcaag gctcagactc tggattgggg attgaaatat      1140
     aacgtcatca agaaggctga cacgctcgaa gagctggcca agatctatgg cattcccgcc      1200
     gatgccctca aggcacaggt agagagctgg aacaaggccg tcgataccgg cgaggacagc      1260
     gagtttggca gacccatgca gaaggcgatg aagctggagc aaggtccctg gtacgccgtc      1320
     cgtatgtggc caaaggttca ttactgcatg ggtggcgtca aggtaaatac ccgctctgag      1380
     gtgttgcatc tggtgaccta caaaccaatt gcaggactgt tcgcagcggg tgaagcaacc      1440
     ggcggtatcc acggcgcgag tcgtctcggt gcctgcgccg ttgctgaagg tgtcgtcaca      1500
     ggccgtaacg ccggccaaat gtgtgccgca tcaaaaagta ttgtgttgaa acacgtataa      1560
//

If you have problems or comments...

PBIL Back to PBIL home page