(data stored in ACNUC7421 zone)

EMBL: CP000821.PE345

CP000821.PE345       Location/Qualifiers
FT   CDS_pept        complement(400647..401804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34958"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ35"
FT                   /protein_id="ABV34958.1"
FT                   /translation="MMKKSTQLMLSAVATAVAMAGSIGCAQAQEDGINIGGSVRVNYGL
FT                   KLYDDSSKDKGGDLVFDTATLVMKGKKGDFGLAAEYRFTKSTNFIKYGYGYYDIDPDWQ
FT                   LQFGINKVPFGNPGFISNSWWFGLPYYLGFEDDHDIGIKAVYEKNGWHTDLAFYKGAEY
FT                   GPSEIKRYATDLFTGTIDTTYDGIDNGTEYNNEETNQLNLRQTYTMEHEGGSTTFGASV
FT                   EAGQIYNNKTGNNGDRYAVAAHMETLYNGWKLQLQAMQYEYDAADAADDNKIGVSVVNW
FT                   QYEIASKGQVYSLNLAKTMPTSWGSVKCYNDFGLMTPDVADSSYDDSIQNVTGCAVSAG
FT                   PTYTMIDFIMGKNMTFSTKNNDHVGLPEFGDDLDKRININFGYYF"
     atgatgaaaa aatccactca acttatgctg tccgctgtag cgacagctgt ggcaatggcc        60
     ggttcgatcg gttgtgctca ggctcaggaa gatgggatta atattggtgg ctcggttcgg       120
     gtcaactatg gcctgaaatt atacgatgac agctcaaaag acaaaggcgg agacctggtt       180
     ttcgacactg cgaccttagt catgaaggga aagaagggag atttcggcct ggccgccgaa       240
     tatcgtttca ccaagagcac caactttatc aaatatggtt acggctacta tgatatagac       300
     cctgactggc agctccagtt tggtattaac aaggttccct tcggtaaccc tggctttatc       360
     tctaatagct ggtggtttgg cctgccttac tacctgggct tcgaagatga tcatgatatc       420
     ggtatcaagg cagtttatga aaagaatggc tggcatacgg atctggcctt ctataaaggc       480
     gccgaatatg gtccgtctga gatcaagcgc tacgctacgg atctcttcac cggcaccata       540
     gataccacct atgacggtat cgacaatggc accgagtaca acaacgaaga gacgaatcag       600
     ttaaacctcc gtcaaaccta caccatggag catgaaggcg gttcgaccac ctttggtgca       660
     tcggtcgaag cgggccagat ctacaacaac aaaaccggca acaatggcga caggtatgcc       720
     gttgctgcgc acatggagac actctacaac ggttggaagt tgcaactaca ggcgatgcag       780
     tatgagtatg acgccgccga tgccgcagac gacaacaaga tcggtgtatc ggtcgttaac       840
     tggcaatatg aaattgcctc caagggtcag gtttacagcc ttaacctcgc caagacaatg       900
     ccaacatcat ggggtagcgt taagtgttac aacgacttcg gtttaatgac acccgatgtt       960
     gcggattcaa gttatgatga cagcattcaa aatgttacag gctgtgcggt ttcagctggc      1020
     ccgacttaca ccatgatcga ttttatcatg ggcaaaaaca tgacattctc aacgaagaat      1080
     aatgaccatg ttggcctgcc tgaatttggc gacgatctgg acaagcgtat taacattaac      1140
     ttcggatatt acttctaa                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page