(data stored in ACNUC7421 zone)

EMBL: CP000821.PE347

CP000821.PE347       Location/Qualifiers
FT   CDS_pept        complement(403972..404430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34960"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ37"
FT                   /protein_id="ABV34960.1"
FT                   /translation="MTFIKALGAQWNKGKLAQQLEQALLQEPEIHSLFIGATTVTTVSN
FT                   LIAAIGFREPETQEQELPLTHEFMLTILFDCFRLLMIKQIEHDNLSQAEHLIIQIAKIW
FT                   ATKEMEEKPDNEICLTQYRELQQQILNLTEQLDELNRQRRLQKRNMGR"
     atgactttca tcaaggcact gggagcgcag tggaataaag ggaagctggc tcaacagctt        60
     gagcaggctc tgttgcagga gcctgagatc cactccctct ttattggagc aactacagtc       120
     accaccgtct ccaacttgat tgcagccatc ggctttcgtg aaccagagac tcaagagcaa       180
     gagctgccac tcacccatga atttatgctc accatactgt tcgactgttt tcggttactg       240
     atgataaaac agattgagca tgacaatctg agtcaggccg aacacctgat cattcagatt       300
     gcgaaaattt gggcaacgaa agagatggag gagaagccag acaatgagat ctgcctgact       360
     caatatcgag agttacaaca gcagatcctc aacctgaccg aacaactcga tgagctcaac       420
     cgacagagac gacttcagaa aagaaatatg ggacgttag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page