(data stored in ACNUC7421 zone)

EMBL: CP000821.PE348

CP000821.PE348       Location/Qualifiers
FT   CDS_pept        complement(404461..405120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0348"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="KEGG: sfr:Sfri_3126 cytoplasmic chaperone TorD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34961"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ38"
FT                   /protein_id="ABV34961.1"
FT                   /translation="MSSLTENELLEYQGIARILHNVLFNDPTPELIQSFIEHDVAQSWP
FT                   EFTGSARESSGRELLSNYLGQWTTDKQQALKLDYAQLFYGPGEPNAVPWGSVYLSERQL
FT                   LNDKTTLALKAFYQEQGISFELDTNQPVDHIGLFFAVLDQLLTQWAQTEDSEAIERSCM
FT                   ILLQQHLLPWSGRCLELMTEHAKTDFYRGIALLTQAYLEGLIQRLNLVPMTTRLYR"
     atgtcatccc ttaccgaaaa tgagctcctg gaatatcaag gcattgcacg tattcttcac        60
     aatgtactct ttaacgaccc gacacctgag ttgatccaga gttttatcga acacgatgtt       120
     gctcagagct ggcctgagtt tacaggttcg gcccgggagt cgagtggtcg cgagttgctg       180
     tccaattatc tcggccaatg gactacagac aaacaacaag ccctgaagtt ggactatgca       240
     caactcttct atggtcccgg cgagcctaat gctgtgcctt ggggatcggt ctacctgagc       300
     gagagacaac tcctcaatga caagacgact ctggcactga aagcatttta ccaagagcaa       360
     gggatcagct tcgagctgga taccaatcaa cccgtggacc atatcggcct gtttttcgcc       420
     gtattggatc agctgctaac ccaatgggct cagactgaag atagtgaagc gatagagcgc       480
     agctgcatga tactgctaca gcaacacctg cttccatggt ctggtcgttg cctcgaactc       540
     atgactgaac atgccaaaac cgacttttat cgcggtatag cattgctgac ccaagcctat       600
     ttagaggggc tgatccaaag attaaacctg gtccctatga caacgcgcct gtatcgttaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page