(data stored in ACNUC7421 zone)

EMBL: CP000821.PE349

CP000821.PE349       Location/Qualifiers
FT   CDS_pept        complement(405205..405840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0349"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: sfr:Sfri_3127 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34962"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ39"
FT                   /protein_id="ABV34962.1"
FT                   /translation="MSNNIQYGFHVDASKCTGCKTCQVSCKDRKDLPVGINWRRVYEYG
FT                   GGQWTENGDGTVSQNVFAYYMSIGCNHCSEPVCVKACPTGAMHKRREDGLVHVAADLCI
FT                   GCESCARACPYDAPQIDKDRKVMTKCDGCYERLAEGKQPSCVESCPMRAIDFGPMDELK
FT                   AKYPGAISPDVAPLPESSVTTPNLLITPNRHTRPSGATDGEVLNYSEV"
     atgagcaata atatccaata cggctttcat gtcgacgcaa gcaaatgtac cggctgtaaa        60
     acctgtcagg tatcgtgtaa ggatcgtaaa gaccttcctg tcggcatcaa ctggcgccgg       120
     gtctatgaat acggtggcgg tcaatggaca gaaaatggtg atggcacagt aagccagaac       180
     gtattcgcct actacatgtc tatcggttgt aaccactgtt ctgagcctgt gtgtgttaag       240
     gcctgtccga ctggtgcaat gcacaaacgc cgcgaagatg gcttagtcca tgtagctgca       300
     gatctgtgta tcggttgcga aagctgtgca agagcctgtc catacgatgc acctcagata       360
     gacaaagacc gtaaggtgat gaccaagtgt gacggttgtt atgagcgttt ggccgaagga       420
     aagcagcctt catgtgtcga gtcttgccct atgcgtgcta tcgacttcgg tcctatggac       480
     gagttgaagg ctaagtaccc tggagccatc tcacccgatg ttgctccgct gccggaaagt       540
     agtgtaacga caccaaactt actaatcaca cctaaccgtc acactcgccc aagtggcgcc       600
     accgatggag aagtgttgaa ctactcagaa gtttaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page