(data stored in ACNUC7421 zone)

EMBL: CP000821.PE35

CP000821.PE35        Location/Qualifiers
FT   CDS_pept        complement(41785..42297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0035"
FT                   /product="Peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: slo:Shew_3736 peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34648"
FT                   /db_xref="GOA:A8FP75"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP75"
FT                   /protein_id="ABV34648.1"
FT                   /translation="MSLLKVLRFPDERLRTIAKPVAEFNADLQAQIDNMFDTMYEEKGI
FT                   GLAATQVDFHQHLIIMDLQDDVERPTVFINMEITARDGSCTNEEGCLSVPGIYANVDRA
FT                   ESVTIKAFDREGVEFTLDADGLFAICLQHELDHLNGKLFVDYLSPLKRQRIKQKLEKAA
FT                   RLEAKQG"
     atgagtttat taaaagtttt acgttttccc gatgagagat tacgcacgat tgcgaagcct        60
     gtagcagagt ttaacgctga cctgcaggct caaatcgata atatgttcga caccatgtat       120
     gaagagaagg ggatcggact ggccgcaacg caagtcgatt ttcatcaaca cttgataatc       180
     atggacctac aagatgatgt agagagaccc acagtgttca tcaatatgga gataactgcc       240
     cgtgatggca gttgtaccaa tgaagagggc tgtctttctg tacctggtat ctatgccaac       300
     gtagatcgcg ccgagtcggt aacgattaag gctttcgacc gtgaaggtgt tgaattcacc       360
     ttagatgcag atgggctgtt tgcgatatgc ctgcaacacg aattagacca ccttaacggt       420
     aagttatttg tggattacct gtcgccatta aagcgccaaa gaatcaaaca gaaactcgaa       480
     aaagcagcca gactcgaagc caaacaagga taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page