(data stored in ACNUC7421 zone)

EMBL: CP000821.PE350

CP000821.PE350       Location/Qualifiers
FT   CDS_pept        complement(405853..408282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0350"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family protein"
FT                   /note="KEGG: sfr:Sfri_3128 anaerobic dimethyl sulfoxide
FT                   reductase, A subunit, DmsA/YnfE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34963"
FT                   /db_xref="GOA:A8FQ40"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ40"
FT                   /protein_id="ABV34963.1"
FT                   /translation="MERRSFLKMSAALSCAATVSGCNSSSKDVEVVPPTPPVAGENLNW
FT                   SACLVNCGSNCPVQVFSTDGVITRVESEFTTTDKYGDHDVRACLRGRSLRKRVYAPDRL
FT                   KYPMKRVGPRGSGQFERISWDEALDLVAEKLQGTIDQYGNESIHFTYNSGARYHFSGKQ
FT                   CLYRLMNLKGGYLNAYGDYSWSQIYEAAGQTYGSAGPGWQGSSVSEMQNSDLVLMVGYN
FT                   PSEIRMSGSGEAYDFLMQKQKNKFKTILIDPRYTDSAVGKEDQWLAIRPGTDAALFEAL
FT                   AYEWITTNTVDQAFLDKYCVGYDEKTMPAGVGYEESYKAYILDNTTVGSSIPGVNAKTP
FT                   EWAAAITGIEAHIIVELARELAAARAPFIQIAASLNRQAAGENNTRAGYMLPILLGQLG
FT                   LPGTNCGGLCKGSFLHAPFMPTGSNPVKKAISFFTFTQAIEDGKNMTVLSDGVQGVDTD
FT                   EEGDGKLGTDIKAIINYGGNALINQHSDVRKTEKLLQDESKCEFILVVDNWMTPSAKFA
FT                   DVLLPDVTWLESEDLIYQSYAAGDTATLVQMSSGVDPMFESRPIYEVCVDLAKRMGVEA
FT                   EFTEGKSRKDWLDQFYAESKAATPGLPDKEVMLTQGIYRKYLPDGGYIVLEDFRNDPEA
FT                   NPLGTPSGKIEIYSSRLADKARTWKLKEGDVISALPKYVPTWEGYEDTETKKKYPLQLT
FT                   GYHTKGRAHSSYHNVPWLREVVQDAVWMNPLDANKRGLKTGDKVHIFNDRGTIEVEVKV
FT                   TPRIMVGVTALGQGAWFQPGGDVDKGGCLNVLTTQRTTPVTKGNPQHTNLVEIRKV"
     atggaacgca gaagtttctt aaaaatgagt gccgcactaa gttgcgcagc gacggtttca        60
     ggctgtaact caagctctaa agatgttgaa gtggtaccgc ctacgccacc tgttgccggt       120
     gaaaacctaa actggtcggc ctgtctggtt aactgtggct ctaactgccc ggtacaggtt       180
     ttctctaccg atggggtgat cacccgcgta gagtcagaat ttaccacaac agataaatat       240
     ggcgatcatg acgtgcgtgc ctgccttcgt ggtcgttcac tgagaaagcg tgtctatgct       300
     cccgatcgcc tgaaataccc gatgaagcgt gtcggccctc gcggcagtgg acaatttgag       360
     cgtatcagct gggatgaagc cctggatctc gtggcagaaa aactgcaagg caccatagac       420
     caatatggta acgaatcgat tcacttcacc tataactcag gtgcgcgtta tcacttctcc       480
     ggtaagcagt gtctctaccg tctgatgaac cttaagggtg gttacctcaa cgcctatggc       540
     gactacagct ggtcacaaat ttatgaggct gcgggacaga catacggctc agcgggccct       600
     ggctggcagg gaagcagcgt ctctgagatg caaaactcag acttagtgct gatggtaggt       660
     tacaacccat ctgagatccg catgagtggt tcgggtgaag cctatgactt cctgatgcag       720
     aagcagaaga ataagtttaa gactatcttg atcgacccac gttataccga ctctgccgta       780
     ggtaaggaag atcagtggct cgctatccgt ccgggtaccg acgcggcact gttcgaagcc       840
     ttagcctatg agtggatcac caccaacaca gtggatcagg ccttcctgga caaatattgt       900
     gtcggctatg atgaaaagac catgcctgcg ggcgttggat atgaagagag ctataaggcg       960
     tatattctcg ataacacaac ggttggcagc tcaattccag gcgttaatgc taagacgcca      1020
     gagtgggccg ctgctatcac aggtatcgaa gcccatatca tcgtcgagtt agcccgtgaa      1080
     ctggctgcgg ctcgcgcacc tttcatccag attgctgcct cactaaaccg ccaggcagcc      1140
     ggtgaaaaca acacccgtgc gggttacatg ctacctatct tgttaggcca gctgggtctg      1200
     ccgggtacta actgtggcgg actgtgtaaa ggctcgttcc tgcacgcacc gtttatgcct      1260
     accggttcta accctgtgaa gaaagctatc tcattcttta ccttcactca ggccatcgaa      1320
     gacggtaaga acatgaccgt tctgtccgat ggtgtacagg gcgtcgatac cgatgaagag      1380
     ggcgacggaa agctaggcac agatatcaag gctatcatca actatggtgg taatgccctg      1440
     attaaccaac actcagacgt gcgtaagaca gagaagctgc ttcaagatga atctaagtgt      1500
     gaattcattc ttgtcgtcga taactggatg acaccgagtg ccaagtttgc cgatgtttta      1560
     ctgccggatg tgacctggtt ggagtcggaa gatcttatct accaaagcta cgcagccggt      1620
     gatacagcta ccctggtaca gatgagcagc ggcgtcgatc ctatgttcga gagccgtcct      1680
     atctatgagg tctgtgtcga tcttgctaaa cgtatgggcg tcgaagccga gtttactgaa      1740
     ggtaagagcc gcaaagactg gctggatcag ttctatgccg agtctaaagc cgctacaccg      1800
     ggactaccgg ataaagaggt gatgctcaca caaggtatct atcgcaagta cctgccggac      1860
     ggtggctata tcgtactgga agatttccgt aacgatcctg aggcgaatcc tctgggcaca      1920
     ccatcgggca agattgagat ctactcttca cgcctggcag acaaagcccg cacctggaag      1980
     ctcaaagagg gtgatgtgat atctgcgctg cctaaatatg tgcctacctg ggaaggttat      2040
     gaagatactg agaccaagaa gaagtatcca ctgcagctca ccggttatca cactaaaggc      2100
     cgcgcacact cgagctatca caacgtccca tggttacgtg aagtcgtaca ggatgccgta      2160
     tggatgaatc cgctcgatgc gaacaagcgc ggactcaaga ctggcgacaa ggtccacatc      2220
     tttaacgacc gaggcaccat cgaagtcgaa gttaaggtga cgcctcgcat catggtcggc      2280
     gtaacggcac tgggtcaggg cgcgtggttc caacccggcg gcgatgtgga taaaggcggt      2340
     tgtttgaacg tcctgaccac acaacgcacg acacctgtaa ctaaaggtaa tcctcagcac      2400
     actaacctgg ttgaaatccg taaggtctga                                       2430
//

If you have problems or comments...

PBIL Back to PBIL home page