(data stored in ACNUC7421 zone)

EMBL: CP000821.PE351

CP000821.PE351       Location/Qualifiers
FT   CDS_pept        complement(408323..410329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0351"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: sfr:Sfri_3129 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34964"
FT                   /db_xref="InterPro:IPR020016"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ41"
FT                   /protein_id="ABV34964.1"
FT                   /translation="MRFKFNLITLSLLAISGAVTGSAMAADFGVNRANTSTVKQETFQC
FT                   KRCPQVDGYTGTVGINAAYIESDDIHSGNAFGTDKDGANASLDADLNYRNGAGYKARFQ
FT                   AHQLGLDNGFAHLEAGKSGRYEITADYQQLTSYQSGDARSQLWYKDGVLTPSEHTQTQE
FT                   LSLQRNKAGLGLSYGRDFYQAYIRYDHENKTGYQSSSIVTPRPVNFGLPVDANTDNLTA
FT                   GLSLSGDNWATDLNYFVSQYKNDIGALSLPYLYDVFAPTPDNEAHQISLSGQYQLSRTV
FT                   MSGRLASGKMIQDDDLIQMSGNPIQNWDGEVETLDGKLSVTSLLSNKLRLGGSVDYSKR
FT                   DNKGSVWEFAQYEVNGITGAFKQNVPLDTERRGLKVNASYRFSSDYRLQAGYDRKEMER
FT                   SHGDREQTNDDVLWAKLNVRALDDIKLKFKASLDNRGGSEYQTSELTSSETNPLLRKYY
FT                   LADRKRTAFEAKFNHTPTSWLSLDMTARYAKDDYDKTQLGLTGSEDYGYDINLGLQLDV
FT                   HLSGYAFAGQQWIDSNQTGSQSFSAPDWSADIEDEFINLGAGFTYTGLLEDKLTLGGDY
FT                   LFANSTSDTLVIYDVVTPQGDYYSFNHSLKLHANYALSEEMALKLAYQYERYYDTDYAQ
FT                   IDVDTVPGLTTLGDLNHNYNAHQVMLSFSYQLR"
     atgagattca aatttaacct catcacgtta tcacttctcg ctatatcggg cgcggtaacg        60
     ggctctgcaa tggcggctga ctttggcgtg aacagggcca ataccagtac agttaaacag       120
     gaaacctttc agtgtaagcg ctgccctcaa gtcgatggct ataccggcac agtcggtatc       180
     aatgccgcct atattgagag tgacgacatt cactccggca atgctttcgg taccgacaaa       240
     gacggcgcta atgccagttt ggatgccgac ctcaattacc gaaacggagc aggctataag       300
     gccaggttcc aggcacacca gctaggtctg gataacggct tcgctcacct tgaagcgggc       360
     aaatccggcc gctatgagat aactgcggat tatcagcagc tgacaagtta tcagtcaggc       420
     gatgcacgca gccagttatg gtacaaagat ggcgtgttga ccccgagcga acatactcag       480
     acccaagagc tctccctgca gagaaacaaa gctggcttgg gtctgagtta tggccgggat       540
     ttctatcagg cttatatacg ttacgaccac gagaataaaa ccggttacca gagcagtagc       600
     attgtcactc cccgtccggt taatttcggt ctgcctgtcg atgccaacac agataacctc       660
     accgcggggc tgtctctgtc aggcgataac tgggctaccg atctcaatta cttcgtgagt       720
     cagtataaga acgatatcgg cgccttaagt ctcccctacc tgtatgacgt ctttgcaccg       780
     actcctgaca atgaagctca tcaaattagc ctgtcgggtc aataccagtt gagccgcacc       840
     gtcatgagcg gtcgtctggc gtcaggcaag atgatccagg acgatgattt gatccagatg       900
     tccggtaatc caatacaaaa ctgggacggt gaggtcgaga ctttagacgg caagctgtca       960
     gtcacctcgc ttttgagtaa taagctcaga ctcggcggca gtgtcgatta cagcaagcgc      1020
     gacaacaagg gctcggtatg ggagttcgct caatatgaag ttaacgggat cacgggcgca      1080
     tttaaacaaa atgttccttt agacaccgaa cgtcgcggtc tcaaggttaa tgccagttat      1140
     cgcttcagca gcgactatcg cctgcaggcc ggctacgacc gcaaggagat ggagcgcagc      1200
     catggcgacc gtgagcagac aaatgatgac gtgctatggg ccaagctcaa cgtccgcgca      1260
     ttggatgata tcaagcttaa gttcaaggcc agtctggata accgtggcgg cagcgaatat      1320
     caaaccagcg aactgacctc atccgaaact aaccccttgc tacggaaata ctacctggct      1380
     gacagaaagc gtaccgcctt cgaagccaaa tttaatcaca ctccgacttc gtggctcagt      1440
     ctggatatga ccgcccgcta cgccaaagat gattacgaca agactcaact gggtctgacc      1500
     ggatctgaag attacggcta tgacatcaac cttgggctgc agctcgatgt gcatctgtct      1560
     ggctatgcct ttgccggtca gcagtggatc gactccaatc aaactggcag ccagagtttc      1620
     tctgccccgg attggtccgc cgatatcgaa gatgagttta tcaacctggg cgctggattc      1680
     acctatacag ggctactgga agacaagctc actctgggcg gcgattacct attcgcaaac      1740
     tccaccagcg acacgttagt catctatgac gtcgtcacgc cgcaaggaga ttactactct      1800
     ttcaaccata gtctcaagct acatgcgaac tacgcattga gtgaagagat ggcgttaaaa      1860
     ctggcttacc agtatgagcg ctattacgac accgattacg cgcaaattga tgtcgataca      1920
     gttccgggac tgaccacctt aggcgacctg aaccataact ataacgcgca ccaagtgatg      1980
     ttgtcgttta gctaccagct gcgctaa                                          2007
//

If you have problems or comments...

PBIL Back to PBIL home page