(data stored in ACNUC7421 zone)

EMBL: CP000821.PE352

CP000821.PE352       Location/Qualifiers
FT   CDS_pept        complement(410345..411298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0352"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: sfr:Sfri_3130 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34965"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020015"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ42"
FT                   /protein_id="ABV34965.1"
FT                   /translation="MMNKCIITKLLCGIFAFACLSLSVQAAPWNQLTGEQLEQKLAEKF
FT                   AQGKYSKKGADSCLMCHKKNDKVMAIFGGVHGNTSQPDSPMAGLQCEACHGPLGKHNKG
FT                   GKEPMIAFGKESKLPAQSQNSVCLGCHNDPKQMAWHSSSHNLDEVACSDCHNIHTDKDP
FT                   VMDQLTVNDTCTSCHTQQKSDMNKRSSHPMKWDQMTCIDCHNPHGSMSESALNHTTVND
FT                   TCYSCHGEKRGPVLWEHAPVTENCANCHNPHGSVNEAMLTHRAPQLCQQCHMDDGHASR
FT                   VVQQGGSDAFGGGKSCLNCHSQIHGSNHPAGSKLQR"
     atgatgaaca aatgtattat cactaagtta ctttgtggga tattcgcttt cgcgtgctta        60
     tctctctcag ttcaggcggc cccctggaac caactcactg gtgaacaact ggagcagaaa       120
     ctggcggaga aatttgctca gggtaaatat tctaagaaag gtgccgattc ctgcctgatg       180
     tgtcataaaa aaaatgacaa ggtcatggcg atattcggtg gagtacatgg caacacgagc       240
     caaccggatt cacccatggc gggtctgcag tgcgaagcct gtcatggacc gttaggtaaa       300
     cacaataagg gcggcaagga accgatgatc gcctttggta aagagagcaa gctgcctgct       360
     cagagtcaga acagtgtttg cctgggatgc cataacgatc ctaagcagat ggcatggcat       420
     agcagcagcc acaatttaga cgaggtggcc tgtagcgatt gtcataatat ccacaccgac       480
     aaagatccgg taatggacca actcacggtc aatgacacct gtacctcttg tcacactcag       540
     caaaaatcag acatgaataa gcgctcatcc catccgatga aatgggatca aatgacctgt       600
     atcgattgcc ataacccaca tggatcgatg agtgaaagtg cacttaacca caccacagtc       660
     aatgacacct gttatagctg tcatggcgag aaacgtggcc cagttttatg ggagcatgca       720
     ccggtcactg aaaattgtgc caactgtcat aacccccatg gcagcgtgaa tgaagccatg       780
     cttactcaca gggcgccgca gctgtgtcag caatgccata tggatgatgg ccatgcaagt       840
     cgtgtcgtac agcaaggtgg aagtgacgcc tttggcggcg gtaagagctg tctcaactgc       900
     catagccaga tccatggctc caaccaccca gccggcagca agctgcagcg ctaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page