(data stored in ACNUC7421 zone)

EMBL: CP000821.PE354

CP000821.PE354       Location/Qualifiers
FT   CDS_pept        414104..414796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_0277 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34967"
FT                   /db_xref="GOA:A8FQ44"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ44"
FT                   /protein_id="ABV34967.1"
FT                   /translation="MSKLERESRLLEVARELILEHGMMSFKFTDIAKRAEVSRATLYKY
FT                   FSGKEDVLVSLFVSDAGNTLQMLLDIQADEILNDREKILLSLLAPVASSMEALNRSGTL
FT                   LLSANPGIFMFAGEAHQAKLEQIVAQIRGIVLEFWVIPFKQGHMRVTQEQLEEVMASTF
FT                   PYQRGCVTIPQNVMTVGKQINYPLKKVFENLLKLTEALDWCEEHANVDYEKTLIGIGRH
FT                   KRNEMIAY"
     atgagtaaac tagaacgaga gtcacgatta ttagaggtcg caagagagct aattcttgaa        60
     catggaatga tgtcgtttaa gttcactgac attgctaaac gtgcggaggt gtctcgagca       120
     accttatata aatatttttc tggtaaagaa gatgttttag taagcttatt tgtcagtgat       180
     gcaggcaata ctttgcagat gttactagat attcaggccg atgaaatctt aaacgataga       240
     gagaaaattt tactcagttt attggctcct gttgcgagct caatggaggc gctgaatcgt       300
     tctggtacgc tattgctcag tgctaatccc ggtatattta tgttcgctgg tgaagcgcat       360
     caagctaagc ttgagcagat agttgctcag atcagaggga tcgttttaga gttttgggtt       420
     atacctttta aacaaggtca tatgagagtc actcaagagc aactggagga ggtcatggca       480
     tcgacatttc cttatcaaag aggatgcgtc accattcctc aaaatgtcat gactgtgggt       540
     aagcagatca attaccctct gaaaaaagtt ttcgaaaacc tattaaagtt aacagaggca       600
     ttagattggt gtgaagagca tgctaatgtc gattatgaga aaactttgat tggtatagga       660
     aggcacaaga gaaacgagat gattgcatat tag                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page