(data stored in ACNUC7421 zone)

EMBL: CP000821.PE355

CP000821.PE355       Location/Qualifiers
FT   CDS_pept        complement(414994..415314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34968"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ45"
FT                   /protein_id="ABV34968.1"
FT                   /translation="MAGWIEDYISKSLDIHPRVFGQVTIGAVSNYISSSAREYIEEAYS
FT                   ADVEIESFIHVCMCSAVCTMGSKRGDVQNIVVYVIKKAAVKCPLLHPLIESVPQSKLTS
FT                   IV"
     gtggcgggat ggatagagga ttacatcagc aaatcacttg atatacaccc aagagtcttc        60
     gggcaagtca ctatcggggc tgtcagtaac tatatatcct cttcggctcg agagtacatc       120
     gaagaggctt acagtgctga tgtagaaata gagtccttca tacatgtctg tatgtgcagt       180
     gcggtgtgta cgatggggag taagagaggt gacgtacaga atatcgtggt ttatgtcatt       240
     aagaaggctg cagtaaagtg cccattactt catcccctca tagagtctgt tccacagagt       300
     aagctcacta gcatagtatg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page