(data stored in ACNUC7421 zone)

EMBL: CP000821.PE356

CP000821.PE356       Location/Qualifiers
FT   CDS_pept        complement(415350..415970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0356"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="KEGG: sfr:Sfri_3126 cytoplasmic chaperone TorD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34969"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ46"
FT                   /protein_id="ABV34969.1"
FT                   /translation="MNKALAEITPILAANMYHDPCDKVLEMYNEHDFSECYPLLTQSNT
FT                   RSEGVALISNYMKQYTSEQLPKLLLDFNQLFIGPGKMKVPLWGSYYLSEDNLLCGPSTQ
FT                   KLQARIDALGIAINTIDGDNQPIDHISLVLRLVEFALDEERSLELKAIVTEHLVPWAYR
FT                   VAELTIEHAKTNFYLGWGLLLKDYLDVLVESNGIIVKEHTLWG"
     atgaacaaag cactagctga aataacccct atcctagcag ccaatatgta tcatgaccct        60
     tgcgataagg tgcttgagat gtataacgaa catgacttca gcgagtgtta ccctctgctt       120
     actcagagta acactcgcag cgaaggagtt gcactcataa gcaattacat gaagcaatac       180
     acgagtgaac aactacctaa actgctgctc gacttcaatc agctgtttat tggtcctggt       240
     aagatgaaag tcccattatg gggctcatac taccttagtg aagataacct gttgtgtggg       300
     ccaagtactc agaaacttca agcgcgcatc gatgctctag gtatagcgat caataccatt       360
     gatggtgata accagcctat cgaccacata tcactcgttc tccgactggt ggagtttgcg       420
     cttgatgaag agaggagttt agagctgaaa gctatcgtta ccgagcatct tgtcccctgg       480
     gcgtatagag tggcagagct aacgattgag cacgctaaaa caaacttcta cttagggtgg       540
     ggattattac ttaaagatta tctagacgtc ttagtagagt ctaatgggat catagtgaaa       600
     gagcataccc tatgggggta g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page