(data stored in ACNUC7421 zone)

EMBL: CP000821.PE357

CP000821.PE357       Location/Qualifiers
FT   CDS_pept        complement(416026..418128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34970"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ47"
FT                   /protein_id="ABV34970.1"
FT                   /translation="MNTKLSLVAVLLAGAMVTGCSDDDSETVYVCENGDTVSAPEQCPT
FT                   TPTDPTDPVEPPAVDGPFVHAGRTIIDGAFYSATSPSNEYDPLRDWENTMPAGYKEMRN
FT                   ASYPWGTTVYNSAANGEELWMGTISNGWCVWPYQNIAMPIELTTFESETTGCSVPGTTG
FT                   TPSQIFIYNFRTGAKEVIHESMLTSGGPQFTEAFKPINNTYGFRAAGTAGDLVFVAGHW
FT                   KTTEDKGRLRLFVFNAKERSFVGYRDIVGDTTRRFRTLEHADGTTGFYTIVGAETGMTQ
FT                   YGDGPTQLLRWVGTQDDPFAGGNIKGTDPLTTTGWSKVSTQLDNEQTPDGVQYGMIGDW
FT                   RQFTHTDGTERLIMSASAHPFVYKNGVRSDKFKESVILISDPIPNSGYTVDEQLTFREV
FT                   FGMDQYDPDTKGRWGAKWGTSAINDGYMYFGTYHQGTDAAYKHFAKADPALFTELTGLE
FT                   SAGEADATKVTDVTTTNDAQATDHKLFMINEWRATSIFRIDLKNIDAVSAGDTSKVELL
FT                   YGYETMEVNDGNGWKTTPNLLGKKPTHGEAGMGNPGNVYSWTSIAKDGKLFWGFFDAFS
FT                   GLHDLLFEAYSGEYMLFDGIVFQNPVWKRQMANNPAMWMYDYAKAEMDANGLGAEFIPG
FT                   GDLLMIEADGSARKLTTNGFGNQCSNGIRNVVDIDDKLYFGTSTWCNVGPTSGLEFYQY
FT                   EPSLDK"
     atgaatacta aactttctct tgtagcagtc cttttagcag gtgctatggt aactggctgt        60
     tctgatgatg attcagaaac agtctatgtc tgtgaaaatg gcgataccgt ttctgctcca       120
     gagcagtgcc ctacaacacc aacagatcct acagatccag ttgaaccgcc agctgtagac       180
     ggtccattcg tacatgctgg tcgtactatt atcgatggcg ccttttacag tgccaccagc       240
     cctagtaacg agtacgaccc actgcgtgac tgggaaaata caatgccagc tggctataaa       300
     gagatgcgta atgcctctta cccttgggga accactgttt ataattcagc agccaatggc       360
     gaagagttat ggatgggtac catctcgaac gggtggtgtg tatggccgta ccagaatata       420
     gccatgccta tcgagttgac tacctttgag agtgagacga caggctgctc agttcccggt       480
     actaccggta ctccatcaca gatcttcatc tacaacttcc gtaccggtgc aaaggaagtg       540
     attcatgaga gcatgctgac atcaggtggt cctcagttta ctgaagcgtt caagcctatc       600
     aataatacct atggcttccg cgccgcgggt actgccggtg acctagtatt cgtcgctgga       660
     cactggaaga ctacagaaga taaaggtcgc ctacgtctat tcgtattcaa tgctaaggag       720
     cgttcattcg taggctaccg cgatatcgta ggtgacacca ctcgtcgctt ccgtactttg       780
     gaacatgcag acggcacgac agggttctac actatcgtcg gtgcagaaac gggtatgact       840
     caatacggtg acggcccgac acagctactt cgttgggtgg gtactcagga cgatccattc       900
     gctggcggta atatcaaggg tacagaccca ctgacgacta ctggctggag caaggtttcg       960
     actcaactgg ataatgaaca gactccagac ggagtacagt acggtatgat cggtgactgg      1020
     cgccaattca cccataccga cggtactgag cgtctgatca tgtcagcctc agcacatcct      1080
     ttcgtgtaca aaaacggcgt acgtagtgat aagtttaaag agtcagtcat tctgatctca      1140
     gatcctatcc ctaactcagg ctacacagta gatgagcagc ttactttccg tgaagtattc      1200
     ggtatggatc agtacgaccc tgacactaaa ggtcgctggg gagctaagtg gggaacaagt      1260
     gctattaacg acggctacat gtacttcggt acttaccacc aaggtacaga tgctgcttat      1320
     aagcacttcg ctaaggcaga ccctgctcta ttcactgagt taacaggtct agagtctgcc      1380
     ggagaagctg atgcgactaa ggtaaccgac gttactacaa ctaatgatgc tcaggctact      1440
     gatcataaac tgtttatgat taatgaatgg cgtgctacct caatcttccg tattgacctt      1500
     aaaaatatcg atgcggtaag cgctggcgac acctctaagg tagagttgct atacggctac      1560
     gagactatgg aggttaacga cggtaacggt tggaagacta caccaaactt actaggtaag      1620
     aagcctactc atggcgaagc gggtatgggt aatccaggta acgtatattc ttggacctca      1680
     attgcaaaag acggcaagtt attctgggga ttcttcgatg cgttctctgg actacatgat      1740
     ctactattcg aagcgtattc cggtgagtac atgttattcg acggtatcgt attccagaac      1800
     cctgtgtgga agaggcaaat ggctaataac ccagccatgt ggatgtacga ttacgctaaa      1860
     gcagagatgg atgctaacgg tctaggcgca gagtttattc caggtggcga tctacttatg      1920
     attgaagctg atggttctgc acgtaagctt actactaacg gtttcggtaa ccagtgctct      1980
     aacggtatcc gtaacgttgt agatattgat gacaaactat actttggtac gtcaacttgg      2040
     tgtaacgtcg gtcctacctc tgggcttgag ttctaccaat atgagcctag cttagataag      2100
     tag                                                                    2103
//

If you have problems or comments...

PBIL Back to PBIL home page