(data stored in ACNUC7421 zone)

EMBL: CP000821.PE358

CP000821.PE358       Location/Qualifiers
FT   CDS_pept        complement(418130..418747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0358"
FT                   /product="anaerobic dimethyl sulfoxide reductase, subunit
FT                   B"
FT                   /note="KEGG: vpa:VP1448 anaerobic dimethyl sulfoxide
FT                   reductase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34971"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ48"
FT                   /protein_id="ABV34971.1"
FT                   /translation="MQLGFYVDTSICSGCKACMVSCKDKNDLNVGRNFRRVYEYAGGSC
FT                   TDNGNGVFSQSVFAYYTSISCNHCDTPACTKACPTGAMHKRSEDGLVMIHDDICIGCSS
FT                   CEQACPYDAPQLDEARGKMTKCDACIDRLNAGKQPMCVDSCIHRALDFGPIDELRAKYG
FT                   DTAEIAPLPSASITKPNLILRVHPDGQPVGSGAGSVVNPNEV"
     atgcaattag gattctatgt tgatacatcg atatgttcag gctgtaaggc ctgtatggtc        60
     tcctgtaaag ataagaatga cttaaatgtg ggacgcaact tccgccgcgt atatgaatac       120
     gcgggtggca gctgtacgga taatggcaat ggtgtgttct cccaatcggt atttgcctat       180
     tacacgtcga tatcttgcaa ccattgtgac acccctgcat gtacaaaggc ctgtccgaca       240
     ggcgctatgc ataagcgctc cgaagacgga ctagtcatga ttcatgacga catctgtatc       300
     ggttgttcat cttgcgaaca ggcgtgtcct tacgacgcgc cccagcttga tgaagcacgg       360
     ggcaagatga ctaagtgtga cgcctgtatc gacaggctta atgccggaaa acagcctatg       420
     tgtgttgata gctgtatcca tcgagcattg gacttcggtc ctatcgatga gttgcgtgcc       480
     aaatacggcg atacggcgga gatcgcccca ctaccgtcag caagtatcac aaaaccaaat       540
     ttaattctta gagttcaccc agacggtcag cctgtaggtt caggtgccgg ttctgtagta       600
     aatccaaacg aggtataa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page