(data stored in ACNUC7421 zone)

EMBL: CP000821.PE359

CP000821.PE359       Location/Qualifiers
FT   CDS_pept        complement(418758..421208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0359"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family protein"
FT                   /note="KEGG: sfr:Sfri_3128 anaerobic dimethyl sulfoxide
FT                   reductase, A subunit, DmsA/YnfE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34972"
FT                   /db_xref="GOA:A8FQ49"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ49"
FT                   /protein_id="ABV34972.1"
FT                   /translation="MERRTFLKFSAAAAAVATVTGCESSSASNPLPAPSEPVLPPVGEG
FT                   ITWGSCATNCWQACPLKVHSKDGVITRIETEGKATDDWDNFDHEIRPCPRGRSMRQKVY
FT                   NHDRLKYPMKRVGRRGSDEFVRISWEEAVSSVASAMEQTYSQYGKNAIFMPLGGGSHDL
FT                   NTGVTQSSVRLLNMAGGCLFFHNDYSAAQYREGSAGMYGYLASNAGDTVGFWNTGSSLR
FT                   SLEDSDLMVCFGYNPMEARLGGAGSGYEYLNVKKKNNFKTYYIDPRFTDTAVTANDEWI
FT                   PIRPGTDAALCEAIAYVLIEDGYADIPFLEQYTHGYDKYQDYITGVTDGTTKTPERAEG
FT                   ICGIPAEKIREIAQAIGAASAPFVTQGFGPQRQGNGENNARAVMMLPLLVGKISGDGTN
FT                   HGGTPGNDGLSHYAMMPADTLQDLMNMKIMDVTIPAASHLDAIEFGMQMKPSTHDVRYS
FT                   NPDLMAADTPLETNVRFLWLASSNMLANQNGDINRADRLLNDESLVDFVVVVEQHMTAS
FT                   AKYADIILPEVSWLEMYDVIQSYNKMDCGSLMYAYGITPAVDPMFECKPAYDICHMIAN
FT                   QLGIGSKFTNGGMTYLDQVRKVFAEFKKSNPWIQGDTFEEFVSFGPQRRPAGEHPNVGK
FT                   IRDFITDPIASPLGTPSGKVEIYSQYFEGKQTQAEGTDEINPLPVYFACDESYEDATAS
FT                   EFPLQCINYHGKHSAHSIHASTPWLNEVLEHHLWLNPIDAGAAGVINGQKVIVESRRGK
FT                   LEITARVTPRIVPGVVAMPQGQWRRMKGDIDVGGCANTLTDSKPSPVAKSFRSNTNRVR
FT                   VYSA"
     atggaacgtc gcacgtttct aaagttctct gcggcagctg ctgcggttgc aactgttact        60
     ggctgtgaga gtagcagtgc cagcaatcct ctgccggccc ctagtgaacc tgtactccct       120
     ccagtaggag aagggattac atggggttca tgcgccacaa actgctggca ggcatgtcct       180
     ttgaaggtac acagtaaaga tggcgtgatc acgcgcattg aaactgaagg caaggctaca       240
     gacgattggg ataacttcga ccacgagatc cgcccctgtc ctcgtggacg ctctatgcgt       300
     cagaaggtct acaaccacga tcgtctcaaa tacccaatga agcgcgtagg acgccgaggc       360
     tctgatgagt tcgttcgtat tagctgggag gaagcagtct ctagcgtcgc ctctgctatg       420
     gaacagacat attctcagta cggcaagaac gctatcttca tgcctctggg cggtggttct       480
     cacgacctga acaccggcgt tactcaatcg agtgtgcgtc tgcttaatat ggctggcgga       540
     tgcttattct tccataacga ttattcagca gcacagtatc gcgaaggttc tgctggtatg       600
     tacggatatc tggcatctaa cgctggtgat accgtcggat tctggaatac aggctctagc       660
     ctacgtagcc tggaagacag tgatctaatg gtgtgtttcg ggtataaccc gatggaagcc       720
     cgcctcggtg gtgctggttc tggttatgaa tacttgaatg ttaagaagaa aaataacttc       780
     aagacgtact acatagatcc caggttcacc gatacggctg tcactgccaa cgatgaatgg       840
     attcctatcc gtccaggtac tgacgcagca ctgtgtgaag cgatagcgta tgtattgata       900
     gaagatggat acgcagatat tccatttctt gagcaataca cccatggata cgataagtac       960
     caagattata tcaccggtgt aacagacggc accactaaga ctcctgaacg cgcagaaggg      1020
     atctgcggca tccctgcaga gaagatccgt gagattgccc aagcgattgg tgcagcatca      1080
     gctccattcg tgacacaagg cttcggacct caacgtcagg gcaacggtga gaacaatgct      1140
     cgagcagtga tgatgctacc attacttgtc ggtaagatta gtggcgatgg tactaaccac      1200
     ggcggcactc caggtaacga tggtctgtcc cattacgcca tgatgccagc tgatactctg      1260
     caggatctaa tgaacatgaa gatcatggac gttacgatcc ctgcggcgtc acatctcgat      1320
     gctatcgagt tcggcatgca gatgaagcca agcacccatg atgttcgcta ctccaaccca      1380
     gacttgatgg ctgctgacac accactagag actaacgtac gctttctatg gctggcctcc      1440
     tcgaacatgt tggctaacca gaatggcgat atcaaccgag cagaccgcct acttaatgat      1500
     gaaagcttag tggattttgt ggttgtcgtt gaacagcata tgacggcatc ggctaagtac      1560
     gcagatatca tcctgcctga agtcagctgg cttgagatgt atgacgtaat ccaaagctac      1620
     aacaagatgg attgtggttc actcatgtat gcctacggga tcacaccagc tgttgaccct      1680
     atgtttgaat gtaagcctgc atatgacatc tgccacatga tcgccaatca actgggtata      1740
     ggtagtaagt tcaccaatgg tggaatgacc tacttagatc aagtccgtaa ggtttttgcc      1800
     gaatttaaga aaagtaaccc atggattcaa ggtgatacgt ttgaagagtt tgtcagcttc      1860
     ggacctcagc gccgccctgc tggtgagcac cctaacgtcg gtaaaattcg cgacttcatc      1920
     actgacccaa tagcaagccc tcttggaaca ccaagcggca aggttgaaat ttactctcaa      1980
     tatttcgagg gtaagcagac tcaagcagag ggtaccgacg agatcaaccc actgccagta      2040
     tattttgctt gcgacgagtc ctatgaagat gcaacggctt cagagttccc attacagtgc      2100
     attaactacc acggcaaaca tagcgcacac agcattcacg ccagtacccc atggctcaat      2160
     gaagtgctag agcatcatct gtggctaaac ccaatagatg caggtgctgc gggcgtaatc      2220
     aatggtcaga aggtcattgt agagagccgc agaggaaagc tcgaaataac cgctcgtgta      2280
     acaccacgta tcgtccctgg tgtagttgct atgccacagg gtcaatggcg ccgtatgaaa      2340
     ggtgacatcg atgtgggtgg ctgtgcaaat acgttgactg atagtaagcc tagcccggtt      2400
     gcgaagtcat tccgctctaa tactaaccga gtcagagtgt actcggcata g               2451
//

If you have problems or comments...

PBIL Back to PBIL home page