(data stored in ACNUC7421 zone)

EMBL: CP000821.PE360

CP000821.PE360       Location/Qualifiers
FT   CDS_pept        complement(421242..422939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3685 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34973"
FT                   /db_xref="InterPro:IPR020016"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ50"
FT                   /protein_id="ABV34973.1"
FT                   /translation="MKAKLTLVALAVLSVNATAANFAVPQDIEKDYACKRCVATEHANT
FT                   VGIITEQRSHLDTQYGASADIKGANYSINAVEAGADNGHLKAAAHLGDFALELAYVNRW
FT                   NLDDNDIGAERQQLSVGAKYQTQLVTAFVKASSEDKQGQRIGSVVDPKPTNYLETIDHT
FT                   TQVMNAGLQLHGDFWNLGVAAFNSEFTDNAGIDADNSAQQASVKAGLNYGSTRLSVSAA
FT                   SGKMIQDEAIEQENSLVPISNFDGEVETLDYSARISSRVAGFKVTGFYSYSDRDNVSGS
FT                   YEFFESINTPIDSSKTRLGVDASYRLGSTKFSAGFEQNDRTRTDSDREETQESEVFGRI
FT                   DYRYQQFNSHIKFISGERTGSEYHIGDDIYQKYYLADRDRVSTELGLGYSQNHYGANLK
FT                   VSIASDEYSNSSALKESDEMSVNVDGFYRFNDQMVLNAYAGTQTIDSLEIHNTTVSDEF
FT                   TYFGFGLDQYQINEDIALGTSYTFSLSGSDTAVDSTEMGDYYQYQHLAEIHMDYRISER
FT                   ISTRFAYSYERNYDTNYANQPIDAINTIDDLNQNYTDHKIGAFFTIKL"
     atgaaggcta aacttacttt agtagcactc gctgttctct cagtcaatgc taccgcagcg        60
     aacttcgctg taccgcaaga tattgaaaaa gactatgcct gtaagcgttg tgtcgccacc       120
     gaacacgcta acaccgtcgg catcataacc gaacaacgta gtcacttaga cactcagtac       180
     ggcgctagcg ccgatattaa aggtgccaac tacagcataa atgcagtcga ggccggcgct       240
     gataatggtc atctaaaagc cgcagcacac ctgggcgatt tcgcactgga gctggcttat       300
     gttaaccgct ggaacctcga cgataacgat atcggcgccg agcgtcagca gttatcggtc       360
     ggggcaaagt accagactca acttgtcacc gcgtttgtta aagcaagtag tgaagacaag       420
     cagggtcagc gtatcggctc tgtggttgac cctaagccga ctaactatct agagactata       480
     gatcacacga ctcaggtgat gaacgccggc ctgcaacttc atggagattt ttggaaccta       540
     ggtgttgccg cctttaactc ggagtttacc gacaatgccg gtatcgatgc cgataacagc       600
     gctcaacaag ccagtgtaaa agcgggtctt aactacggca gcacacgcct aagtgttagc       660
     gcagcttccg gcaagatgat tcaggacgag gctatcgagc aggaaaactc gctggtgcct       720
     atctcaaact tcgatggtga agttgagaca ctagactaca gtgcccgtat cagctctcgc       780
     gttgcagggt tcaaggtaac tggtttctac agctacagtg accgcgacaa tgtcagcggc       840
     tcatatgaat tttttgaatc tatcaacacg ccaatcgata gcagcaagac acgtttaggt       900
     gtcgatgcca gctaccgttt aggcagcact aagttcagtg caggtttcga gcagaatgac       960
     cgaacccgca ccgacagcga ccgtgaggag acccaagaga gtgaggtctt tggccgtata      1020
     gactaccgtt atcaacagtt taactcccat attaaattca tcagcggtga acgtacgggc      1080
     tctgagtacc atatcggtga cgatatctac cagaagtact atctggcgga cagagaccgt      1140
     gtcagtactg agctgggact gggttacagc caaaatcact acggtgccaa ccttaaagtc      1200
     agtatcgcca gtgatgagta cagcaacagc tcggcactga aagaatctga cgagatgtcg      1260
     gttaacgtcg acggcttcta tcgtttcaac gaccagatgg tgctcaacgc ctatgctggt      1320
     acacagacca tcgatagcct ggagatccac aacaccacgg ttagtgatga gtttacctac      1380
     ttcggttttg gtttagacca gtaccaaatc aatgaggata tagcgctagg cacctcctac      1440
     accttctcat tatctggcag tgacaccgcc gtagacagca cagaaatggg ggactattac      1500
     caataccaac accttgctga aatccatatg gattaccgca taagtgagcg tatttcgacc      1560
     cgttttgctt acagctatga gcgcaactac gacacgaact acgccaacca accgattgat      1620
     gccatcaata ccattgacga cctcaatcaa aactacaccg accacaagat cggtgcattt      1680
     ttcacaatta agctgtaa                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page