(data stored in ACNUC7421 zone)

EMBL: CP000821.PE362

CP000821.PE362       Location/Qualifiers
FT   CDS_pept        complement(424401..425414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0362"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: sfr:Sfri_3878 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34975"
FT                   /db_xref="GOA:A8FQ52"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ52"
FT                   /protein_id="ABV34975.1"
FT                   /translation="MYSNHNEIRSKLALLQLAKELGSISKACDMMGYSRDSYYRFKKQY
FT                   ENAGEQGLHNLSRKKSTLKNRVSQEVEDQVIEIALDYPNYGQAKVAELLTARGCTISPS
FT                   GVRTIWLRHNLETKQNRLIALNSRLRQQNELDFNAQHQIEKSCKLQQEEGSLDCQGPGD
FT                   ICVQDTFKIGNIPGLGTVYQHTCMDAYSQYTHAHITLEKSSTISSDFLRTQVLPWYKNQ
FT                   YIPINSILTDRGAEFSGKYSQQFQNLLQQTAINHIQKRAYNGPIVNGIAARFHNLAHSE
FT                   FYAPFLKNNKVSNIETLNENLQKWLKRYNHQYAIAGRYTLGKTAIEVIELSRHLYR"
     atgtattcaa atcataatga gatccgaagt aaacttgcgc tattacaact agccaaagag        60
     cttggaagta tcagtaaagc ctgcgatatg atgggttaca gccgagacag ttattaccgc       120
     tttaagaagc agtatgagaa tgccggcgag caagggctac acaatctatc gagaaagaag       180
     agcacactta agaatcgggt ctcacaggaa gtggaagatc aggtcataga gatcgcactc       240
     gattatccga actatggcca ggccaaggtg gcggaactct taaccgcgag gggatgtacc       300
     atatccccca gcggggttag aaccatctgg ttacgtcata atctggagac taagcagaat       360
     cgcttaattg ccttaaacag tcgtcttcga cagcaaaatg agctcgactt taacgctcag       420
     catcagatag aaaaatcgtg caaacttcaa caggaggagg gcagcctaga ctgccagggt       480
     cccggtgata tttgcgtgca ggacaccttc aaaattggca atattccggg actgggcact       540
     gtctatcagc acacctgcat ggatgcctat agccaataca cgcatgcgca tataacgctg       600
     gaaaagagct caacaatatc ctctgacttt ctccgcacgc aggtacttcc ctggtataag       660
     aaccaatata tccctatcaa tagcattttg accgatagag gcgccgaatt cagtggaaaa       720
     tatagccagc agtttcaaaa tctacttcaa caaaccgcta ttaaccatat tcagaaaagg       780
     gcttataacg ggccgatcgt taatggtatt gccgcccgat ttcacaacct tgctcacagc       840
     gagttttatg cgccattctt aaagaacaat aaggtatcaa acatagagac gttaaatgaa       900
     aatttgcaaa aatggcttaa gcgctacaac catcagtacg caattgccgg aaggtatacc       960
     ttaggtaaaa cggccatcga ggtgatcgaa ctcagtcgac acttgtatag ataa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page