(data stored in ACNUC7421 zone)

EMBL: CP000821.PE364

CP000821.PE364       Location/Qualifiers
FT   CDS_pept        427389..428024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34977"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ54"
FT                   /protein_id="ABV34977.1"
FT                   /translation="MSELKIGEISKPRFEFRTFGQDFSVAAERMARLSVPVPEKVWRRE
FT                   SDEIYIMSRTNDLNNTKIRDGKMDVKAYVQTVNGLEQWDPKLKAEFPISKTQLVEEIFP
FT                   AFMVEIPALAKQEYSFEEFISIIDAHPDLQAVKIHKERYGYMVNNTICEVANVLVNGAS
FT                   LVSVNSESVELDDIQRTVSDLRLEGVENINYLQAIKRVIGMKNLPLAN"
     atgtctgagt taaagattgg agagatatcc aagccacgct tcgagtttcg cacgtttggt        60
     caggatttca gcgtagcagc ggagcgtatg gctcgtttat cggttcctgt acctgaaaaa       120
     gtttggcgtc gtgaaagtga tgaaatctat atcatgtcac gtactaatga tcttaataac       180
     acgaaaatcc gtgatggaaa gatggatgtt aaagcttatg tgcaaaccgt taacggtctt       240
     gagcagtggg atccaaaact gaaagcagag tttcctatct cgaaaacaca gctggttgaa       300
     gagattttcc ctgcatttat ggttgaaatt ccggctctcg ctaagcagga gtattctttc       360
     gaagaattta tctcgattat cgatgcacat cctgatctac aagcggttaa gatccacaaa       420
     gagcgttatg gctacatggt aaacaacact atctgtgaag ttgccaacgt actggtcaat       480
     ggcgccagcc tcgtgagtgt aaatagtgag tctgtagagc tggatgatat tcagaggaca       540
     gtttcagatc tacgtttaga gggggtggaa aacatcaatt acttacaagc catcaagcgt       600
     gtgatcggca tgaaaaatct tccattggca aactag                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page