(data stored in ACNUC7421 zone)

EMBL: CP000821.PE366

CP000821.PE366       Location/Qualifiers
FT   CDS_pept        428526..429851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA2016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34979"
FT                   /db_xref="GOA:A8FQ56"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ56"
FT                   /protein_id="ABV34979.1"
FT                   /translation="MLSLSIADQYHLKISVEIPPEQQSLQWKVFFFFPAKLVQHSDSMS
FT                   SALFYRNLLQQQKLVKLEAVTHQGVKHDLLILRKTAYAVAKVNKTLYRSALADFVAASL
FT                   EMLTEKSDEELLDFARYLDKFHQIHDDEEHLSQRKLFKLADHLLLYHYHQALLKAKHSA
FT                   IKEEKAQYSLRIKNLTAYAESENHKLTHDSEFGREKLLDRLQLAQRILNRPYQLRRKML
FT                   NSGMLAEQLIFGFAAAFAMAFATAAAFMTQKAFGNFSTPFFFSLVLSYIFKDRIKELGR
FT                   NYLMEKYFAHYFQHHYRFYKGSDSEVVFDAKETLYRLNSENIKDLLKKVRKAFSSSDSN
FT                   AFKEALVYQRSYTAHVKKQQLVSAKFVDNLTLNLSGRLRSLPRVIRRHWKEADRNIQAV
FT                   NVEQIHPVYLAFEVKTDSGISHKIYKLTASRKGIHALVEAVE"
     atgttgtcgc tatcaattgc cgatcagtac catttgaaga tatctgtcga aatacctccg        60
     gagcagcaga gtctgcaatg gaaagtattc ttcttcttcc ctgcaaaact ggtacagcat       120
     agcgacagca tgagtagcgc actgttttat cgtaatttac tgcagcagca gaagttagtt       180
     aagcttgaag ctgtcactca tcagggtgtt aagcatgatt tactgattct caggaaaacg       240
     gcttatgcgg tggccaaggt taacaaaacc ctctatcgaa gtgcattagc cgattttgtt       300
     gcggccagtt tggagatgct gacagaaaag agtgatgagg agctgctgga ttttgctaga       360
     tacctggata agtttcatca aatacatgac gatgaagaac acttgtctca gcggaaactg       420
     tttaagcttg ccgatcatct cctcctttat cactatcatc aagcattgtt aaaagcgaag       480
     catagcgcga ttaaagagga gaaagcgcag tactccttga ggataaaaaa tcttacagcc       540
     tatgcagaaa gtgaaaatca taaattaacc catgattcag agtttggccg ggagaagtta       600
     ttagaccgtt tacagctagc ccaacgaatt cttaatcgcc cctatcaact gaggcgcaag       660
     atgctgaaca gcggcatgtt agccgaacag ttaatctttg gatttgccgc ggcgtttgcc       720
     atggcttttg ccacggctgc tgcatttatg actcagaagg cgtttggtaa cttttcgacg       780
     cccttctttt tctctctggt tctgtcatat atttttaagg atcgcattaa ggagttggga       840
     agaaactact taatggagaa gtattttgcc cactatttcc agcatcatta tcgtttttat       900
     aaaggcagtg attcggaagt tgtatttgat gcaaaagaga cactgtatcg gctgaatagc       960
     gaaaatataa aagatttgct gaagaaggta cgtaaggcat tctcttcgtc tgacagtaat      1020
     gcatttaaag aggcgctggt gtatcagaga agttatacgg cccatgtaaa aaaacagcag      1080
     ttagtatcag ctaagtttgt tgataatctt acactcaatt tgagtggtcg attgcgttca      1140
     ttacccaggg ttatcagacg acactggaaa gaggctgata ggaatataca agccgtaaac      1200
     gttgagcaga tacatcctgt ctatctcgca tttgaggtga aaactgattc aggaatatca      1260
     cataagatct ataagctaac ggctagcagg aaggggattc acgcattagt ggaggccgtt      1320
     gagtaa                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page