(data stored in ACNUC7421 zone)

EMBL: CP000821.PE368

CP000821.PE368       Location/Qualifiers
FT   CDS_pept        431489..432313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34981"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ58"
FT                   /protein_id="ABV34981.1"
FT                   /translation="MRNNLLLIGLVNLCLSSSAYALSPGEFTSLEYHVNTGVGKTLPYA
FT                   AKAQTSSFKQAFNFIEFDDELSQKLVTYIDTPDRAFKAESIQIRVREHLTKPRKSKITV
FT                   KLRAKAPEGFGELSNYKKAEIDYTKGKAAYSVSYDIPYSPGDIDVKKLDMELVFNLLKK
FT                   NEVVWDMLGPIYEGNKKQFIQTVVMRTNEWEGTLKDDRFSNLEIDFQLWTPYYRKPRVT
FT                   FTEFSFKGHVSDKAKLEEAYQFLYQKVQEVGFSSGHQGSKTKATFKMTEGFK"
     atgagaaaca atttattgtt aattggttta gttaaccttt gcctcagctc aagtgcttac        60
     gccttgtcgc cgggggagtt cacatcactc gaatatcatg tcaatacggg ggtggggaaa       120
     actttacctt atgcagctaa agcacagaca tcatcgttta agcaggcatt taattttatt       180
     gagtttgatg atgagttatc tcaaaaactc gtgacctata ttgatacgcc tgacagagct       240
     tttaaggctg aaagtattca aatccgtgtt cgtgagcatc tgactaaacc tagaaagagc       300
     aagataactg ttaagttgag agcgaaagcg cctgaagggt ttggtgagct atcaaactat       360
     aagaaggccg agatagacta taccaaaggt aaggcggcat acagtgtaag ctacgatata       420
     ccctattctc ctggtgatat cgatgtcaaa aaattggata tggaactcgt ttttaacttg       480
     ttgaaaaaga acgaagtagt ctgggatatg cttggtccaa tttatgaagg caataagaaa       540
     cagtttatcc agacggtagt gatgcgtact aatgaatggg aaggaaccct gaaagatgat       600
     cgcttcagta atctggaaat tgattttcaa ctttggaccc cctattaccg taaaccgcgg       660
     gtaacattta ccgagttttc ctttaagggg catgtgagtg acaaggcgaa gcttgaggag       720
     gcgtaccagt tcctctatca gaaggtacaa gaggttggct tttctagtgg tcatcaaggc       780
     tccaaaacca aagcaacatt caaaatgacg gagggattta agtaa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page