(data stored in ACNUC7421 zone)

EMBL: CP000821.PE369

CP000821.PE369       Location/Qualifiers
FT   CDS_pept        432396..433064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0369"
FT                   /product="protein of unknown function DUF47"
FT                   /note="KEGG: sfr:Sfri_3884 protein of unknown function
FT                   DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34982"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ59"
FT                   /protein_id="ABV34982.1"
FT                   /translation="MFGFSRVTSLLSQSKSTEASIYTFLEQVTLSHHAFVQLWKAYLRH
FT                   GADSEEFKSTLDELQRIEQHADNLKREIENTLYRKTLIPDLRSDVASLIELTDRLINKQ
FT                   ETIGLHLDIEKPLIPVEVEEDLLLLLNVVGDTIDHALLCAKSFFTDLQRVQEYHKKTIM
FT                   FESDADKVCTRAKTILFETDQPLINKVQLRYFFDRIDQVANLAEDISDRISIFTLKRVQ
FT                   "
     atgtttggct tttctcgagt cacctcttta ctttctcaaa gcaaatctac agaagcgagc        60
     atttatacat ttttagaaca agtcacatta tctcatcatg catttgttca gttatggaaa       120
     gcctatttaa gacatggcgc tgacagtgaa gaatttaaaa gtacattaga tgagttacaa       180
     agaattgagc aacatgcaga taatttaaag agagagattg aaaatactct gtatagaaaa       240
     acgttaattc cagatcttcg ctccgatgta gcatcactaa tagaattaac tgacaggctt       300
     ataaataaac aagaaacaat cggacttcat ttagatattg aaaaaccatt aatcccagtc       360
     gaagttgaag aggatctatt attgttgttg aatgtggttg gcgatacaat tgaccatgct       420
     ctattatgtg ctaaaagttt tttcaccgat cttcaacgtg ttcaggaata tcataaaaaa       480
     acaatcatgt ttgaaagcga tgcagataaa gtgtgtacca gagctaaaac tattttattt       540
     gaaacagacc agccattaat aaataaagtt cagttgcgct acttctttga ccgaatagat       600
     caggtggcta atttagccga agatatcagt gaccgcatct cgatattcac actaaaacgc       660
     gttcaatag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page