(data stored in ACNUC7421 zone)

EMBL: CP000821.PE37

CP000821.PE37        Location/Qualifiers
FT   CDS_pept        43565..44671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0037"
FT                   /product="DNA protecting protein DprA"
FT                   /note="KEGG: slo:Shew_3734 DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34650"
FT                   /db_xref="GOA:A8FP77"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP77"
FT                   /protein_id="ABV34650.1"
FT                   /translation="MITEKLVDWLVVSAVSGLGPARIQQLLNYMDVEELRQRLEHEKDA
FT                   LPLPESLLKRELAPDFSLVDSALDWLQSSSHHHIVTLDDPHYPNLLKQISDPPSILFIK
FT                   GEPDTLLLPSIAVVGSRAATSAGLQSAYQLAGELGSIGFSVSSGMAAGVDGAAHQACID
FT                   NSAKTIAVLGTGVEVIYPRRHKKLYEKIQCHGAVISEFWPDVKPYAGNFPKRNRIISGL
FT                   SLGTLVVEACRRSGSLITARLALEQGREVFAVPGNILGGQSQGCHDLLRDGAKLVENAA
FT                   DIIEEVSVLCDFHLEELKSRHHIGGENASDLPFTSLLASVGYETTPIDVVVEHSGKAIE
FT                   LVLEQMLELELQGWVAVVPGGYVRLRRS"
     atgattactg aaaaactggt cgattggctg gttgttagtg cagtatccgg gttaggacca        60
     gcccggattc aacaattgct caactacatg gacgtagagg aacttaggca gaggttggag       120
     catgagaaag atgctttgcc tctaccggag agtctgctca agcgtgagct tgcccccgat       180
     ttttctcttg tcgattcggc gttagactgg ctacaaagtt cgtcacatca ccatattgtc       240
     accttagatg atccccatta tccgaatttg ctgaaacaga tttccgatcc tccatcgata       300
     ttgtttatta agggggagcc cgacacgctt cttctaccga gtattgccgt cgttggcagc       360
     cgtgcagcaa cgagtgcagg cttacaatca gcttaccaac tggcgggtga gctcggatcc       420
     attggttttt ctgtatccag tggaatggcg gcgggagtcg atggcgcagc acatcaggca       480
     tgtatcgata acagtgccaa aaccattgca gtattgggaa cgggggttga agttatttac       540
     cctcgtagac ataagaaact atatgagaaa attcaatgcc atggtgcagt cattagtgaa       600
     ttttggccgg atgtaaagcc ttatgcagga aattttccga aacgaaacag gattatcagc       660
     ggtctatcat taggtacgct tgttgttgag gcctgtcgga gaagtggatc attaatcacc       720
     gccagattgg cgttggaaca gggaagagag gtgtttgcag ttccggggaa tattttgggt       780
     gggcagagcc agggttgcca tgatctattg cgagatggtg caaaacttgt cgagaatgcg       840
     gccgatataa tagaggaagt gtcagtttta tgtgattttc accttgaaga actgaaaagt       900
     cgtcaccata taggggggga gaacgcttca gatttgccat ttacctcact gttagctagt       960
     gttggttatg agaccactcc aattgatgtt gtggttgagc atagtggaaa agccatagag      1020
     ttagtattag agcaaatgct tgaacttgag ctacaaggtt gggtcgctgt agtacccggt      1080
     ggttacgtaa gactaaggag gagctag                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page