(data stored in ACNUC7421 zone)

EMBL: CP000821.PE371

CP000821.PE371       Location/Qualifiers
FT   CDS_pept        435056..436882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34984"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ61"
FT                   /protein_id="ABV34984.1"
FT                   /translation="MRSHLLALSVLPFAFSAIASSSLDALYGPIMPPAYIKAYEVNNHH
FT                   QIALNPYLQVGNADNPIILDEGEGYVWVIDKDGNFVIAPEVTSPWGRKYKEGMMRIEDG
FT                   KPKKWGYKEKYGHTALIGGSKARIGGELEMENGQWIMNNKSGRYNKRRPGRTEEAMHNA
FT                   GDLLIAIAPQIAELDYEYLKDYGPAKPISLKVMKDIEWHYMIDDDYFWDAEGKKLGKAF
FT                   VEKTPFIDWRAKVKFKEGFYMDTQDRFLKSQDEIFRVRLDVSKPRKSKFTHKLRSSDIT
FT                   DLKPMIDGEGEVDVSIGGDLYSLATDTGFNFLNFDFYNANSEEIFEYLMFADRRAYKQM
FT                   TPLMRYGADKVLKTDIMRQSKYKGWLNTGPFAGHEIEIQIWKKIIEPGKFGKEGKYSEP
FT                   LLLEIGFEGKTKNREELNKLNTWLYGKLKSADLLAKDQSQSKTEIAFAVSKRFDAKKTP
FT                   KLPQVAPEVKIAAIDGIKTRNLDGTINVKTNGDKQVIAGQKGVQGEVYQTALNGKPLSV
FT                   VVLGGKGNIKQALAKVVGAKGELLVAVAAGSSLDNPKSRAKLAAKLDGGNALKGYELLG
FT                   DTARDYLKPIIKKNMDIKARSNQHYYWSGVAE"
     atgagatcac acctactcgc actatctgtt ctaccgtttg cctttagcgc tatcgcttca        60
     agtagtttgg atgcacttta tggtcctatc atgccgccag cctacattaa ggcttacgaa       120
     gtaaataacc atcatcagat cgcattgaat ccctacctgc aagtaggtaa tgctgacaac       180
     cctatcatcc tggacgaagg ggaagggtat gtttgggtta tcgacaagga tggcaacttt       240
     gttattgccc ctgaggtgac gtctccctgg ggaaggaagt acaaagaggg catgatgaga       300
     atcgaggatg gtaagcctaa aaaatgggga tacaaagaga agtacggaca cactgcctta       360
     atcggtggaa gtaaggctcg tattggtggt gagctggaga tggaaaatgg tcaatggata       420
     atgaataaca aatccggccg ttacaacaag cgccgtccag gtcgcaccga agaggcaatg       480
     cataatgcgg gtgacctgct gatcgctatc gcaccacaaa ttgccgaatt agattatgaa       540
     tatttaaagg attatggccc ggctaaacct atctcattaa aggtgatgaa agatatcgag       600
     tggcactaca tgatcgatga tgactatttt tgggatgcgg aaggaaagaa actaggcaaa       660
     gcatttgtcg agaagacccc ctttatcgat tggcgagcca aggtcaagtt taaagagggg       720
     ttctatatgg atacccagga ccgcttcctg aagagtcagg atgagatttt ccgggttcgt       780
     ttggacgtca gtaagccgcg taaatcaaaa tttacccata agcttcgctc atcggatatt       840
     accgacctga aaccaatgat cgatggtgaa ggagaggtgg atgtttctat cggtggcgac       900
     ctatacagcc ttgctaccga tactggtttc aacttcttga acttcgattt ctataatgct       960
     aattctgaag aaattttcga atacctgatg tttgcagata ggcgtgcata caagcagatg      1020
     acgccactga tgcgttatgg tgccgacaag gtgttaaaga ccgacatcat gcgtcaatct      1080
     aagtacaaag gttggctcaa taccggtccc tttgccggcc atgaaattga aattcagatc      1140
     tggaaaaaga tcatcgagcc cggaaagttc ggtaaggagg gcaagtacag cgagcctcta      1200
     ctgctggaga taggcttcga aggtaaaacc aagaaccgcg aagagctcaa caagttaaac      1260
     acctggctat acggtaagtt gaagagcgca gatctactgg ctaaagatca gtctcaatct      1320
     aagactgaga ttgcttttgc agtcagtaag cgcttcgatg ccaagaaaac ccctaagctt      1380
     cctcaagtcg ctccagaggt taagattgcc gctatcgacg ggatcaagac tcgtaatctc      1440
     gatggcacta tcaatgtaaa gactaacggt gataagcaag taatcgcagg tcagaaaggt      1500
     gttcagggcg aggtgtacca aacagccctg aatggtaagc cgctttcggt tgtcgtgtta      1560
     ggtggtaagg gcaacataaa gcaggcttta gcaaaagtgg ttggtgctaa aggcgagctg      1620
     ttggttgctg tggctgcagg ctcttctctg gataacccta aaagccgggc aaaacttgcc      1680
     gctaagttag atggtggtaa tgcacttaaa ggttatgagt tactgggtga tacagcaagg      1740
     gattacttaa agcctatcat caagaaaaat atggatatta aggctcgcag taaccagcat      1800
     tactactggt caggcgtcgc agaataa                                          1827
//

If you have problems or comments...

PBIL Back to PBIL home page