(data stored in ACNUC7421 zone)

EMBL: CP000821.PE373

CP000821.PE373       Location/Qualifiers
FT   CDS_pept        438266..438928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0373"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="KEGG: slo:Shew_2230 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34986"
FT                   /db_xref="GOA:A8FQ63"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ63"
FT                   /protein_id="ABV34986.1"
FT                   /translation="MRIMLLGAPGVGKGTQAQFIMEKYGIPQISTGDMLRAAVKAQSPL
FT                   GLEAKLLMDSGQLVSDNLIIGLVKERIVQDDCAKGFLLDGFPRTLPQADAMVANGIDID
FT                   HVVEIDVPDEEIVKRMGGRRIHPGSGRVYHTVFKQPKVEGKDDLTGEALIIRADDEEST
FT                   VRSRLDIYHQQTKPLVKYYGKLADFGKLTYNKFDGTQSVADVSAAIVKAHQAFAPSI"
     atgcgtatta tgctattagg cgcaccgggt gtaggtaagg gaacccaggc gcagttcatt        60
     atggaaaagt acggcatccc ccagatctcg acaggtgata tgttacgtgc agccgttaag       120
     gctcagagcc ctttggggct ggaagcaaaa cttctgatgg atagtggtca attggtttct       180
     gataatttaa ttattggctt agttaaggag cggatcgttc aagacgattg tgctaaaggt       240
     ttcttattag atggtttccc tcgcactttg ccgcaggccg atgccatggt ggcaaacggt       300
     atcgatatcg atcatgtggt tgagatcgat gtgccggatg aggagatcgt gaaacgtatg       360
     ggggggcgtc gtattcatcc ggggtcaggt cgtgtttacc ataccgtgtt taagcaaccg       420
     aaagtcgaag gtaaggatga cctgaccggt gaggcgctga ttattcgcgc cgatgatgag       480
     gagagtacgg tacgaagtcg tctggatatc tatcatcagc agacaaagcc gctggtaaag       540
     tattatggca aattggcaga ctttggaaag ctgacctata acaagtttga cggcacccaa       600
     agcgttgccg atgtcagtgc cgctatagtt aaagctcacc aagcgtttgc gccatctatc       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page