(data stored in ACNUC7421 zone)

EMBL: CP000821.PE374

CP000821.PE374       Location/Qualifiers
FT   CDS_pept        complement(439043..439681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0374"
FT                   /product="ERCC4 domain protein"
FT                   /note="KEGG: spc:Sputcn32_3619 ERCC4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34987"
FT                   /db_xref="GOA:A8FQ64"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ64"
FT                   /protein_id="ABV34987.1"
FT                   /translation="MNKTLIEIAYDDREHAEILIEQLSLHTELCLVRKRLKLGDYQINN
FT                   WLIERKTLPDLVFSLCNGRLFSQIARLSKCSDNAALLIEGSSKDIASYDITREALIGAL
FT                   CSISINFNIPILRSLSQYESAKILYFCATQLNSRETGLKLNGRKPKRRKNRQLFILQSL
FT                   PEVGPRLARRLLKHFDSVEAVITASTDELIKVEGIGQERARKIREMLIP"
     atgaataaga ctctaattga gatcgcctat gacgataggg agcacgcgga gatattgatc        60
     gaacagctgt cactccacac agaactgtgc ctggtcagaa aacgtctgaa gctcggcgat       120
     tatcaaataa acaactggct tatagaaaga aaaactctgc ctgatctcgt attttctctc       180
     tgtaacggtc gactgttttc acagatcgcg cgattatcaa agtgttcaga caatgcagca       240
     ctgcttatcg aaggttcctc taaagatatt gcatcttatg acattactcg agaagcatta       300
     attggtgcac tgtgctctat ttcaattaac ttcaacattc ccatcctacg cagtttatct       360
     cagtatgaat cggctaaaat tctctacttt tgtgccacgc aattaaacag tagagaaaca       420
     ggattaaaac tcaacggaag aaaaccgaaa cgtaggaaaa accgtcagct tttcatacta       480
     caaagcctac ctgaagtagg tccccgatta gcaaggcgat tattaaagca ctttgatagc       540
     gtcgaagccg tgatcacggc atcaacagat gaactcatca aagtcgaggg tatcggacaa       600
     gagagggcac gaaaaatacg cgaaatgtta atcccataa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page