(data stored in ACNUC7421 zone)

EMBL: CP000821.PE375

CP000821.PE375       Location/Qualifiers
FT   CDS_pept        complement(439843..441147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0375"
FT                   /product="HipA domain protein"
FT                   /note="KEGG: she:Shewmr4_3395 HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34988"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ65"
FT                   /protein_id="ABV34988.1"
FT                   /translation="MSGSNFHILEMHFRGMVIGAIGFDIDTEQFSIEYTKPWQEKGFPI
FT                   SPRLPLDGQASSSQISIYLTNLLPENKGLDHLIEALGIAKSNTFGLIKGIGFDTSGAIL
FT                   YLPVGTKPPATSFTPICKEDLIKRIEDPEHWPMEVWDGKPRLSVAGVQSKLNLFHSDKE
FT                   YGFGEGELCSTHIIKFEKNNQHLVLNEFITMTLAGLIGMQVAKVDIMPIGKYKALSVTR
FT                   FDRMYEPERHIVMRRHQIDVCQALGFSVSRKYERNFGSGRDVQDIREGVSLERLFSIAE
FT                   HCANPAQAKFDMLRWTIFNLLVCNADSHGKNYSFYVTPDGLEPTPWYDLVNVQMYPDFD
FT                   QELAMAIGDEFEADKIHAYQLMTFAEECGIKQNILELSLKQLAKAIIGNLDKAAKQTGE
FT                   ITDAESKYVETYKKTIQARCEYYLAQVEEMKHIKL"
     atgagtggtt ctaactttca catcctagag atgcacttta gaggcatggt tattggggcg        60
     ataggttttg acatagacac tgaacagttc tctatcgaat acactaaacc ttggcaggaa       120
     aagggctttc caatttcacc aaggctccca cttgatggcc aagccagcag ttctcaaatt       180
     tccatttacc tgactaacct actgcccgaa aataaagggc ttgatcacct cattgaagcc       240
     ctaggcattg ccaaaagtaa tacatttggt ctgatcaagg gcattgggtt tgatacctct       300
     ggtgcaatat tgtatctgcc tgtgggcacc aaaccaccag caacctcttt tactccgatt       360
     tgcaaagaag acctcatcaa acgaatcgaa gatcctgaac attggccgat ggaagtctgg       420
     gacggaaaac cacgcctttc agttgctgga gttcaatcaa aattaaacct attccacagc       480
     gacaaagaat acggatttgg tgaaggtgaa ctctgctcaa cccacatcat taaatttgaa       540
     aaaaacaatc agcacctcgt acttaacgaa tttattacca tgacacttgc cggcctcatc       600
     ggcatgcagg ttgcgaaagt tgatataatg ccaataggga aatacaaagc attatccgtt       660
     acccgcttcg atcgcatgta cgaacctgag cgccatattg taatgcgtcg tcaccagatc       720
     gatgtatgtc aggctctggg attttccgtc tcaagaaagt atgaacgaaa ttttggtagt       780
     ggacgtgacg ttcaagatat tcgtgaagga gtgagtctag aaaggctgtt tagcatcgct       840
     gagcactgtg ctaatccagc acaagccaag tttgacatgc ttcgttggac aatctttaac       900
     ttactcgtct gcaatgcgga ctcacatggc aaaaactatt cattctatgt aactcctgat       960
     gggcttgaac cgaccccatg gtatgatctt gtcaacgtgc agatgtaccc tgattttgat      1020
     caagagcttg ctatggctat tggtgatgag ttcgaagctg acaagatcca cgcctaccaa      1080
     ttgatgacat ttgctgaaga atgtggaatt aagcaaaaca tacttgaatt atcgctcaag      1140
     caactggcga aagcgattat cggcaatctg gataaagcgg caaaacaaac cggggagatt      1200
     acggatgcag aatccaagta tgttgagacg tacaaaaaaa ccattcaagc acgatgtgaa      1260
     tactacctgg ctcaggttga agaaatgaaa cacattaagc tatag                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page