(data stored in ACNUC7421 zone)

EMBL: CP000821.PE377

CP000821.PE377       Location/Qualifiers
FT   CDS_pept        complement(441797..442660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0377"
FT                   /product="YicC N-terminal domain protein"
FT                   /note="KEGG: slo:Shew_3489 YicC N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34990"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ67"
FT                   /protein_id="ABV34990.1"
FT                   /translation="MIQSMTAYARIEHKAEWGTASWEIRSVNQRYLETYLRLPEHFRNL
FT                   EPVLRDRLRKRLNRGKIEVNLRYDLADNSSNELQINQDLAKQLINAANWVKEEAGQGEL
FT                   NLVDILKWPGVMSGSEQDMDALGKELLVAFDSAIDQFIEARGREGAAINTMLQTRLDAI
FT                   VEQVTIVREHMPTVMQWQRDKLINRLAEITGELDPARMEQEMVILAQKMDVAEEMDRLD
FT                   AHVAETQRILKKGGAQGRRLDFMMQEFNRESNTLASKSISAEVTAAAVELKVLIEQMRE
FT                   QIQNVE"
     atgatccaaa gtatgacagc ctatgctcgt atcgagcaca aagccgagtg gggtaccgcc        60
     tcttgggaaa ttcgttccgt caatcagcgc tatttagaaa cctacctgcg cctacccgaa       120
     cattttcgca atctggagcc agtactaaga gaccgtctgc gtaaacgttt aaaccgtggc       180
     aagattgaag ttaacctaag atatgacctc gccgacaata gcagtaatga actgcagatc       240
     aaccaagatc tagctaagca gctgattaat gctgctaact gggtaaaaga ggaagccggt       300
     cagggtgaac tgaacctggt cgatatctta aagtggccgg gcgtcatgtc aggctctgag       360
     caagatatgg atgcattggg caaagagctg ttagttgctt tcgattcggc aatcgatcaa       420
     ttcatcgaag cacgtggccg tgagggtgca gcaatcaaca ccatgctaca aacacgcctc       480
     gatgccatcg ttgagcaagt cactatcgtt cgcgaacata tgcctaccgt tatgcagtgg       540
     caacgtgaca agttgattaa tcgtttagcc gagatcactg gcgagctcga tccggctcgt       600
     atggagcaag agatggttat tcttgctcag aagatggatg tcgccgaaga gatggacagg       660
     ctcgatgccc atgttgccga gacacaacgt atccttaaga aaggtggcgc acagggccgc       720
     cgtttagact ttatgatgca agagtttaac cgcgaatcta acaccttagc ctctaagtct       780
     atcagcgccg aagtcactgc cgccgcagta gagcttaagg tgttaatcga gcagatgcgt       840
     gaacagatcc aaaacgtaga ataa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page