(data stored in ACNUC7421 zone)

EMBL: CP000821.PE38

CP000821.PE38        Location/Qualifiers
FT   CDS_pept        44674..45147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0038"
FT                   /product="protein of unknown function DUF494"
FT                   /note="KEGG: slo:Shew_3733 protein of unknown function
FT                   DUF494"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34651"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP78"
FT                   /protein_id="ABV34651.1"
FT                   /translation="MFDILMYLFENYVHSEVEFLVDEDELTQELTRAGFHQSEIIKALS
FT                   WLENLAELQEGDTPYLCDHDQHSFRIYTQKEMDKLDVECRGFLLFLEQIKVLSVETREM
FT                   VIDRVMELDETALILEDLKWVVLMVLFNAPGNESAYEQMEDLIFEQPDGRLHS"
     atgtttgata tcctcatgta tctatttgaa aactatgttc acagcgaagt agaattctta        60
     gtggatgaag atgagcttac tcaggagctc acccgtgctg gttttcatca gtccgaaatt       120
     attaaagcat tatcttggct tgaaaactta gccgagctgc aagagggtga tacaccgtat       180
     ctttgtgatc acgaccaaca ctctttccga atttatactc agaaagagat ggataagctt       240
     gatgtcgaat gtcgtggctt tctacttttt ctggagcaga ttaaagtgct cagtgtagaa       300
     actcgtgaaa tggtaatcga tcgggtcatg gagctggatg agacagccct gattctggaa       360
     gatcttaaat gggttgtttt aatggtgtta tttaatgcac cgggaaatga gtctgcttat       420
     gaacagatgg aagatctgat ctttgagcaa cccgatggac gattacactc ttaa             474
//

If you have problems or comments...

PBIL Back to PBIL home page