(data stored in ACNUC7421 zone)

EMBL: CP000821.PE381

CP000821.PE381       Location/Qualifiers
FT   CDS_pept        complement(445480..447444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0381"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="KEGG: slo:Shew_3485 peptidase S9, prolyl
FT                   oligopeptidase active site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34994"
FT                   /db_xref="GOA:A8FQ71"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ71"
FT                   /protein_id="ABV34994.1"
FT                   /translation="MKLIKFFSFACLTILSYNAVAKIESPAEVFSRSAEFSNVKISPGG
FT                   DYLSTITTKDGKQVLIILDAKTRKPLHSVYFSTNAQVGDYQWVNDERVVLQKVYLKGWQ
FT                   DHPLYYGELMAVNADGSKPVYLFGYAQKGQQTGTRIKKNTPIRATAYILDPMPENKRYM
FT                   LVKALPWGSGSSNTAENLQQVYRVDVYKGKRKKLVTSPISYANFLTDDEGEVRFVSGTR
FT                   DYINSRLFYREDNLWVDTDKLQLNLEQMRPIAFGDDKDSVYVVGSEPGKNKGIYLINIK
FT                   TGTKKLVSRDDVVDPYNVWINQNNKKLYAVEFENGYPSYEFVDKQDARAKLIKQLLASL
FT                   PGHQIHLVSETTDANQFIIKAFNDRNPGDYYLFNTETMKLEYLVSQKNWLDPELMAEVK
FT                   PISFTSRDGKKIHGYLTLPNNIEAKNLPLVVNPHGGPHGPRDWWGFDAQNQLIASQGAA
FT                   ILQINFRGSGGYGKEFEHLGHQKWGTDIQYDIIDGTKYVIEQGLVDKDRICIAGGSFGG
FT                   YSALMAPTLAPDMFKCAIGFAGVYDLPLMFKEGDVQSRRAGERYLEKVLGEDTKVLQSM
FT                   SPTHNVDKLKTKLLLVHGGDDERAPIEQFEALEDALNERNYPYQKLIMDDEGHGFYNDD
FT                   HQAKYYGEMLSFLKENLKL"
     atgaaactaa ttaagttttt tagttttgct tgcctcacaa tcctcagcta taacgctgtg        60
     gcaaaaatag aaagtccagc cgaagtattc agccgttcgg ccgaatttag taacgtaaaa       120
     atctcccctg gtggagacta cctcagcacg ataaccacaa aagatggcaa acaagttctg       180
     atcattttag atgcaaaaac cagaaaacca cttcattcgg tctatttctc caccaacgct       240
     caggttggcg actatcaatg ggtcaacgat gaaagagtgg tgcttcagaa agtgtatctg       300
     aaaggctggc aagatcatcc gctctattac ggcgagctga tggccgttaa cgccgacggt       360
     tcaaaacctg tatatttatt tggttatgct caaaaaggac aacagacagg caccagaatt       420
     aagaaaaaca caccgataag agccacggcc tacatccttg atcccatgcc agaaaacaaa       480
     cgctacatgc tcgtaaaagc ccttccttgg ggctcgggca gtagtaatac tgctgaaaat       540
     ttacagcagg tttatcgtgt cgatgtctac aagggcaagc gtaagaagct cgtcacatcc       600
     ccaatctcat atgccaactt cttaaccgat gatgaggggg aggttcgatt tgtcagcggc       660
     accagagatt acatcaactc ccgcctcttc taccgagagg ataacctttg ggtcgataca       720
     gacaagctgc agttaaatct ggagcagatg cgacccattg cattcggcga tgataaagac       780
     agtgtctatg tcgttggcag tgaacccgga aaaaataaag gcatatacct gatcaatata       840
     aaaacgggaa ccaagaaact ggtaagccgg gatgatgtgg tcgatcccta caacgtctgg       900
     atcaatcaaa ataacaagaa actctacgcc gttgaatttg aaaatggtta tcccagttat       960
     gaattcgtag ataaacaaga tgctcgcgca aagctgataa aacagttgct tgcatcttta      1020
     cccggacatc agatccacct agtcagtgaa acaactgatg cgaaccaatt cataataaag      1080
     gcatttaacg accgcaaccc cggtgattat tatctgttta acaccgagac catgaagctc      1140
     gaatacctgg tatctcaaaa aaactggctc gatcccgagt taatggccga ggttaagcct      1200
     attagcttta ccagccgaga cggtaaaaaa attcatggtt atctcactct gccaaacaat      1260
     attgaagcga aaaacttacc cttagtggtc aatcctcatg gcggaccaca tggaccaaga      1320
     gactggtggg gattcgatgc tcaaaatcag cttattgcca gccaaggtgc cgcaatatta      1380
     cagataaact tccgtggttc tggcggatac ggtaaagagt ttgaacacct tggccatcag      1440
     aaatggggca ctgatattca gtatgacatc atcgatggga ctaaatatgt catcgaacag      1500
     ggattagtag acaaagaccg catctgtatt gccgggggca gcttcggcgg ttattcagca      1560
     ttgatggcac caacacttgc ccctgacatg tttaaatgcg ctatcggatt cgcaggtgtc      1620
     tacgatctcc cattaatgtt taaagaggga gacgtacaga gtcgtcgtgc tggcgagcgt      1680
     tacctggaaa aggtcttagg tgaagacact aaggtcttgc aatctatgtc accgactcat      1740
     aatgtcgata agctcaagac caaactctta ctggttcatg gtggagatga tgaacgtgcg      1800
     ccaatcgagc aatttgaagc actggaagat gccctgaatg agcgtaacta tccttaccag      1860
     aaactcatta tggacgacga aggtcatggc ttctacaacg acgaccatca agcaaagtac      1920
     tatggtgaga tgttgagctt cctgaaagag aacctcaaac tataa                      1965
//

If you have problems or comments...

PBIL Back to PBIL home page