(data stored in ACNUC7421 zone)

EMBL: CP000821.PE385

CP000821.PE385       Location/Qualifiers
FT   CDS_pept        450403..451080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0385"
FT                   /product="DNA repair protein RadC"
FT                   /note="KEGG: sbl:Sbal_0377 DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34998"
FT                   /db_xref="GOA:A8FQ75"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ75"
FT                   /protein_id="ABV34998.1"
FT                   /translation="MGIKDWPDGEGPREKLLKLGVGPLSDAELLAVVLRNGVQGLSAVE
FT                   LARNLIGQFGGLRELLTASEIEVCRMPGMGPVKFAQLQAAAELSKRISQQNLKRGKILS
FT                   DPDLTRDYLMRQLADRAYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPRDVVCLVLE
FT                   KKAAAVIVCHNHPSGVAEPSLADRRITERLKFALETIDVSLLDHMVVGDREIVSFAERG
FT                   WID"
     atggggatta aagattggcc cgatggagaa gggccaaggg aaaaactttt aaaattaggt        60
     gttggaccgt tatccgatgc ggagttgctt gctgtcgttc ttagaaatgg cgtacagggc       120
     ttaagcgctg ttgagctggc gcggaatctg attggtcaat tcggcgggct tagagaactt       180
     ctcacggcct ctgagattga ggtgtgcaga atgccaggta tggggccggt aaagtttgct       240
     caacttcagg cggcagccga gttaagcaag cgaatttccc aacaaaattt aaaaagagga       300
     aaaatattga gtgatcctga tttaactcgg gactatttaa tgagacaatt agcagatcgt       360
     gcctatgaag tgttcgctat tttattgttg gatagccaac atagagtaat tcagtttgtc       420
     gaattattcc gtggcaccat agattcagcc tcggtatatc cgcgtgatgt ggtatgcctg       480
     gtgcttgaga aaaaggccgc ggccgtgatt gtctgccaca accatccatc aggagttgcg       540
     gagccaagtc tggccgatag gcgaattact gagcgattga agtttgcact cgaaaccata       600
     gatgtttcct tgctagatca tatggttgta ggcgatcgcg agatagtttc atttgcagag       660
     cggggatgga tagattaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page