(data stored in ACNUC7421 zone)

EMBL: CP000821.PE386

CP000821.PE386       Location/Qualifiers
FT   CDS_pept        451208..451444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0386"
FT                   /product="ribosomal protein L28"
FT                   /note="KEGG: slo:Shew_3480 ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34999"
FT                   /db_xref="GOA:A8FQ76"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ76"
FT                   /protein_id="ABV34999.1"
FT                   /translation="MSRVCQVTGKKPMVGNNRSHAKNSTRRRFLPNLQNHRFWLEGEKR
FT                   FVKLRISTKGMRIIDKKGIEVVVAELRARGEKV"
     atgtcaagag tatgccaagt aactggcaag aaaccaatgg ttggtaacaa ccgctcacac        60
     gcgaaaaact cgacacgtcg tcgtttttta cctaacctac aaaaccatcg tttttggtta       120
     gaaggcgaaa agcgtttcgt taagctacgt atctctacta aaggtatgcg tatcatcgat       180
     aagaaaggta ttgaagttgt tgttgctgaa cttcgtgccc gcggcgagaa ggtataa          237
//

If you have problems or comments...

PBIL Back to PBIL home page