(data stored in ACNUC7421 zone)

EMBL: CP000821.PE389

CP000821.PE389       Location/Qualifiers
FT   CDS_pept        complement(453603..454499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0389"
FT                   /product="rarD protein"
FT                   /note="KEGG: son:SO4243 rarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35002"
FT                   /db_xref="GOA:A8FQ79"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ79"
FT                   /protein_id="ABV35002.1"
FT                   /translation="MLDSEHRKGIAFALCAYTLWGFAALYFKLLDHVSATEILIHRVIW
FT                   SFVFVTMLMFIFGGFSRLRQVLKRPKQLAVLTLTSVLIAGNWLLFIWAVNNDHMLDASL
FT                   GYFINPLVNVMLGMVFLSERLRKLQWCAVALAGAGVLVQLISFGSIPLVSLGLAFSFGL
FT                   YGLLRKKVNVDAKTGLLVETAILFPIAMIYLFANMGDALTNLMTNTLSNNLLLMAAGIV
FT                   TTIPLLCFAAAAVRIPLSMLGFFQYIGPSIMFILAVTLYKEPFDLEKGITFAFIWSALI
FT                   LFSIDMLYKRKKPLRES"
     atgcttgact ctgaacaccg caaaggcatt gcattcgcgc tttgtgccta tactttgtgg        60
     ggctttgctg ccctctattt taaattactc gatcacgttt cagcgactga aattttgatc       120
     catcgtgtga tctggtcatt tgtttttgtg accatgctca tgttcatttt tggtgggttc       180
     tccaggctga gacaagtatt gaaacgccct aaacagctgg cggtactcac actgacatcc       240
     gtcctgatcg caggaaattg gctgctattt atctgggcag tgaataatga ccacatgctg       300
     gatgccagtc tgggatattt catcaaccct ctggttaatg tcatgctagg tatggttttt       360
     cttagcgaac ggctaaggaa gctacaatgg tgtgccgtag ccttagccgg ggccggtgtg       420
     ctggttcagt tgatctcgtt cggctcgatt cccctggtct cactgggcct ggctttctct       480
     ttcggtttat acgggttact gcgaaagaag gtcaatgtcg atgccaagac aggactatta       540
     gtcgaaaccg cgattctctt tcctatcgct atgatctatc tgttcgccaa tatgggggac       600
     gcactcacta atctgatgac caatacccta tctaacaacc tactcttgat ggcagcgggt       660
     atagtcacaa ccataccgct actctgtttc gccgccgcag cggttagaat tccgctctcc       720
     atgctgggat tctttcaata tatcggcccc agcatcatgt ttatactcgc agttacgctc       780
     tacaaagaac cctttgatct ggagaagggg atcacctttg ctttcatctg gagcgcattg       840
     atcctgttta gtatcgatat gctctataag cgtaaaaagc ctctgagaga gtcctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page