(data stored in ACNUC7421 zone)

EMBL: CP000821.PE390

CP000821.PE390       Location/Qualifiers
FT   CDS_pept        complement(454745..455209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0371 uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35003"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ80"
FT                   /protein_id="ABV35003.1"
FT                   /translation="MTNPIQEQTLRRVAEVFDKQVPFHNLLGLDIKRYDLDGVEVVINM
FT                   KPELIGNIHQQILHGGVTATVLDVVGGLTVFAGLVASREDWSIEDLQSRLQTLGTIDLR
FT                   VDYLRPGRGMQFTGTGTVIRAGNRVSVCRMELHNEQGSHIAFGTGTYMVG"
     atgactaacc cgattcaaga gcagacactt cgtcgagtcg ccgaggtatt cgataaacag        60
     gttcccttcc ataatttatt ggggctcgat atcaaacgct atgatctcga tggtgtcgag       120
     gtcgttatca acatgaagcc tgagctcatc ggtaatattc atcagcagat acttcatggc       180
     ggagtcacgg ctacggtact cgatgttgtt ggtggtctca cggtttttgc gggtttggtt       240
     gccagccggg aagactggag cattgaggat ctacaaagtc gattgcaaac attaggcacc       300
     atagacctgc gtgtcgatta cctaaggccg gggagaggga tgcaatttac cggcactgga       360
     actgtgatac gtgcaggcaa ccgagtttct gtttgtcgca tggagcttca caatgagcaa       420
     ggctctcata ttgctttcgg aacagggaca tacatggtgg gttaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page