(data stored in ACNUC7421 zone)

EMBL: CP000821.PE392

CP000821.PE392       Location/Qualifiers
FT   CDS_pept        complement(457338..459089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0392"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: slo:Shew_3473 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35005"
FT                   /db_xref="GOA:A8FQ82"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ82"
FT                   /protein_id="ABV35005.1"
FT                   /translation="MDFRIVVLSLTFWLAPVWASTSVPLDTIDTLIYQYPSAALIEIND
FT                   LEAISSPVKLSETEKLRLALFRCETFLQLGENEAAINLARISEAKAKILKLEQARPYFL
FT                   NCMAGAFTNYGDFRQALPILDSSILLSRELKQPQSLVNGLRLRGIIDTQVDSYSSAFED
FT                   LSLAIDIYPDAQNQEQGWTLPPLIYIQIPLSKLLAKKTKIRQAFEIIERAADSKEFQGK
FT                   VRVVLTTHMAKMAQLNQYSSSDNLIQQAKTLLPELGTAFELAISYTEMAQLEYKRKNFI
FT                   RAIQLLEISLNTFKKQKKTIEELRAQRLLGEVLLASGNTDKALKLINKSISAGLRTSHY
FT                   AELILSYQVLGSYYASIGDFKQAHLYQLKRFDAAENSFNFIKDTRLLQLNARVSRQQQV
FT                   FKTELLQSNSSINVGQGFKSGYIAILLTLLFGFILGVITIRYKKRTIQAPLAIEPQSRE
FT                   HKIERLISNSKQAGYPLSLVVIHTADVYQTNLPLLISRIENLLRDQDLVINREDGELLL
FT                   LLPHTKEGGTLRVIEQIKEIITPLLNGNKTKIGYARMQQHDSLSSLIKRAHIQQLRQTK
FT                   IDKEPTG"
     atggattttc gtatcgtcgt gctaagcctg acattctggc tcgcgccagt gtgggcgagt        60
     acatctgtac cactcgatac gatcgacact ctcatctatc aatatccaag tgcagcgtta       120
     attgagataa acgatctcga agccatctcc tctccggtaa aactctctga aacagaaaag       180
     ctcagacttg ccctattcag gtgtgaaacc tttttacagc taggtgagaa cgaagcggcg       240
     attaacctag ccaggatcag cgaagccaaa gccaaaatcc tcaagcttga gcaggcgcgc       300
     ccctattttc tgaactgtat ggcgggtgca tttaccaatt acggtgattt caggcaggca       360
     ctgcccatac tcgactcatc tattttgttg tccagagagc tcaaacagcc acaatcttta       420
     gtcaatggcc tgaggttgag aggcatcata gatacacaag ttgatagcta tagcagcgca       480
     ttcgaagatc taagtttagc tatcgatatt taccctgatg cacagaatca agaacagggt       540
     tggactctac ctcctctcat ctatattcag ataccactca gtaagctact ggcaaagaag       600
     acgaagatca gacaagcttt tgagattatt gaacgcgccg cagactcaaa ggagtttcaa       660
     ggcaaggtgc gggttgtact tacaacccac atggctaaga tggcacagtt gaatcaatat       720
     tcttcaagtg acaacttaat tcagcaagcc aaaactctac ttcccgaatt aggcactgcg       780
     tttgaactgg caatcagtta cacagagatg gctcaactcg aatataagag aaaaaatttc       840
     atccgtgcga ttcaactact cgagatcagc ctgaatacct ttaaaaaaca gaaaaagacc       900
     attgaggaat taagagcaca gcgcttatta ggggaagtgt tgctggcaag cggtaacaca       960
     gacaaagcac taaagttaat caacaaatca ataagtgcag gattgcgaac atctcactac      1020
     gcagagttga tactcagcta tcaagtatta ggcagctatt atgcgagtat tggagacttt      1080
     aaacaggctc acctgtatca actaaagcgt ttcgatgcgg cagaaaactc ctttaacttc      1140
     atcaaagata ctcgcttgct tcagttaaat gccagagtca gcagacaaca gcaggtcttt      1200
     aaaactgagt tattacaaag caactcatcg ataaacgttg gccaggggtt taagtccggc      1260
     tatatcgcaa ttctactgac actgttattt ggctttattt taggtgtcat aaccatcagg      1320
     tataagaaga gaacaatcca ggcaccacta gccattgaac cacagagccg tgaacataaa      1380
     atcgaacggt taatcagtaa cagtaaacag gctgggtatc ccctaagcct cgtcgtcatt      1440
     cacactgcag atgtttatca aaccaatctt ccactactca tctccagaat cgagaattta      1500
     ctgcgagatc aggacttggt aataaacaga gaagatgggg aactcttgct attgcttccc      1560
     catactaagg agggtggcac attaagggtc atcgagcaga taaaggagat cattacgcct      1620
     ttattgaatg gcaataaaac aaaaattggt tacgctcgca tgcaacaaca tgacagcctg      1680
     agctcattaa taaagcgtgc ccatatacaa caactcagac aaactaaaat cgataaagaa      1740
     ccgacaggct ga                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page