(data stored in ACNUC7421 zone)

EMBL: CP000821.PE395

CP000821.PE395       Location/Qualifiers
FT   CDS_pept        462332..463732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0395"
FT                   /product="3-isopropylmalate dehydratase"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: slo:Shew_3470 3-isopropylmalate dehydratase,
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35008"
FT                   /db_xref="GOA:A8FQ85"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ85"
FT                   /protein_id="ABV35008.1"
FT                   /translation="MAKTLYEKVWDSHVVVENEGQAPLIYVDRHLVHEVTSPQAFSGLK
FT                   VAGRKLRAPEKTFATMDHNTSTKSASLDALSPMARIQVETLQDNCKEFGVRLYDIHHKN
FT                   QGIVHVMGPELGITLPGTVIVCGDSHTATHGAFGALAFGIGTSEVEHVMATQTLRQNKA
FT                   KTMKIEVRGHVAAGITAKDIVLAIIGKIGMDGGTGYVVEFCGEAIEALSMEGRMTVCNM
FT                   AIEMGAKAGMVAPDGITAEYLKGREFAPKGESWEQAIAAWAELKTDEDAIFDASVVLEA
FT                   SDIAPQLTWGTNPGQVVAIDGLVPNPEDESNATVKASIEKALEYVALSAGTCMTDVSIN
FT                   KVFIGSCTNSRIEDLRDAALHAKGRKVAAGVTAIVVPGSGLVKEQAEAEGLDKIFLEAG
FT                   FEWRLPGCSMCLAMNDDRLEAGDRCASTSNRNFEGRQGRGSRTHLVSPAMAAAAAVAGH
FT                   FVDIRKAY"
     atggcaaaga cattatatga aaaagtatgg gacagccatg tggtggttga aaacgaaggt        60
     caggcgccgt taatctatgt ggacagacat ctggttcatg aggtgacgtc tccacaggca       120
     ttcagtggtc tgaaggtcgc ggggcgcaaa ctgcgtgcac cggaaaaaac cttcgccacc       180
     atggatcaca acacgtcgac taagagcgca agcctcgatg cattgagccc catggcccgt       240
     atccaggttg aaaccctgca ggataactgc aaagagtttg gtgttcgcct gtatgacatt       300
     catcataaaa accaaggtat cgtccatgtg atgggtcctg agcttgggat caccctgccc       360
     ggcacggtta tcgtgtgtgg tgattctcac accgcaaccc atggcgcatt tggtgccttg       420
     gcgttcggta tcggcacctc agaagtcgag catgtgatgg cgacgcagac attgcgtcaa       480
     aacaaagcta agacgatgaa aatcgaggtg cgtggtcacg tcgccgctgg gattactgct       540
     aaagatatcg tgctggcaat tataggtaag attggcatgg atggcggtac gggctatgtg       600
     gtcgaattct gtggtgaggc gattgaagca ctttctatgg aaggtcgcat gacggtgtgt       660
     aatatggcta tcgaaatggg tgccaaagcg ggcatggtcg ctccggatgg gatcactgcc       720
     gagtacctta agggtcgtga atttgcgcct aagggagagt catgggagca agctatagcc       780
     gcatgggccg agcttaaaac agatgaagat gccatattcg atgcaagcgt tgtgcttgaa       840
     gcatcagata tcgctcctca gctcacctgg ggaacgaatc cgggtcaagt cgtcgctatc       900
     gacggtttgg taccaaaccc tgaagatgag tctaatgcca cggttaaggc cagcatagag       960
     aaggcgctgg aatatgtggc gcttagtgca ggaacttgta tgactgatgt gagcattaat      1020
     aaggtcttta tcggctcatg tactaactct cgtatcgaag atctgcgtga tgcggcgcta      1080
     catgccaaag gccgtaaagt ggccgcgggt gtcaccgcga tagttgtgcc tggatctggt      1140
     ttagtgaagg agcaggcaga agctgaaggg ttagataaga tcttcctcga ggcagggttt      1200
     gaatggcgtc tgccgggttg ttctatgtgc ttagctatga atgatgacag attagaagcc      1260
     ggtgatcgct gcgcctctac cagtaatcgt aatttcgaag ggcgccaggg acgaggcagt      1320
     cgtactcatc tcgtgagccc cgctatggct gcagctgcgg cagtagccgg tcattttgtc      1380
     gatattcgta aagcatacta g                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page