(data stored in ACNUC7421 zone)

EMBL: CP000821.PE396

CP000821.PE396       Location/Qualifiers
FT   CDS_pept        463746..464351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0396"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="KEGG: slo:Shew_3469 3-isopropylmalate dehydratase,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35009"
FT                   /db_xref="GOA:A8FQ86"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ86"
FT                   /protein_id="ABV35009.1"
FT                   /translation="MNPFTSHTGLAVMIDSANVDTDQIIPKQFLSKVTRDGFGVHLFHD
FT                   WRYLDEAGDEPNPGFSLNLPRYKGASILISKENFGCGSSREHAPWALADFGLRAIIAPS
FT                   FADIFYGNSINNGLLPVRLTDVEVQQLMDEVEASEGAEITVDLEELTVTSPSGAVFNFE
FT                   IAGSARHNLLNGLDAIGLSLACADQIARYEAQLPTWKA"
     atgaatccat ttacttcaca cactggactt gcagtgatga tcgatagtgc taacgtcgat        60
     accgatcaaa ttattcctaa gcagttttta tctaaggtga cccgggatgg ctttggggtt       120
     cacctgtttc atgattggcg ttatctcgat gaggcaggcg atgagccaaa ccccggtttc       180
     agcctcaacc tgccaagata caagggcgcc tctatcctta tctctaaaga gaactttggt       240
     tgtggttcga gtcgtgagca tgctccctgg gcattagccg attttggatt gcgagccatc       300
     atagcaccga gttttgccga tattttttat ggtaactcga tcaataatgg cctgcttccg       360
     gttcgtctga ccgatgttga agtccagcag ttgatggatg aagttgaggc cagtgaaggc       420
     gcagagatca cggtagacct tgaggaactc acggttacct ctccatcggg tgcggtattt       480
     aactttgaga tagccggttc ggcaaggcat aacctactta atggcctgga tgctatcggt       540
     ttgagtttgg cttgtgcgga tcagatagcc cgctatgagg cacaattgcc gacttggaaa       600
     gcataa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page