(data stored in ACNUC7421 zone)

EMBL: CP000821.PE397

CP000821.PE397       Location/Qualifiers
FT   CDS_pept        464841..466178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0397"
FT                   /product="long-chain fatty acid transport protein"
FT                   /note="KEGG: son:SO4232 long-chain fatty acid transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35010"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ87"
FT                   /protein_id="ABV35010.1"
FT                   /translation="MTLKMRETMNKRILSMAVAAAIVGSVTQVQAAGFQLAEYSATGLG
FT                   RAFAGEAAMADNAAAQFRNPAMMTYLSGTQVAGGAILVMPNIDINGEVTFVDGTNPTSA
FT                   NDIADDAVVPNFYVTHQLNEQWFLGLALGSNFGMATELDDSFRGTQFGNEASVTTIEIN
FT                   PNIAYRINEQFSVGAGVRFVIGEGSIGAKSSADSVLPTPMGNLPVPKGTTLKYMEGDDT
FT                   SWGWQLGAAWQINDSNRIGVNYRSAVDQNLEGEANGLAFNPMDPTLKMDGAMELSLPAT
FT                   AELASFHQLTEKLAIHASINWTDWSSFEKLEAVIPALSEPTQLVKQENWKDSYRFALGT
FT                   TYDLSQKSTLRAGVAYDRSAVSDANRTLTIPEMDRLWLSAGYGYHYSDNLDLDFGVTYI
FT                   FADESPVVEPRPGIESDRSSALFGGTFSGTTSGNIMLVGVQASYRF"
     atgactttga aaatgagaga gacaatgaac aagcgcattt tatctatggc cgtggctgcg        60
     gcgattgttg gatcggttac acaagttcag gctgccgggt ttcagttagc agaatactca       120
     gcaaccgggc ttggccgtgc attcgccggt gaagctgcca tggctgataa tgccgcggcg       180
     caatttcgca atccagccat gatgacttac ctgtcaggta cgcaagttgc tggtggcgct       240
     attttggtta tgccaaatat cgatatcaac ggtgaagtga cctttgttga tggtacaaat       300
     ccaacctctg caaacgatat tgctgatgat gccgttgtac caaatttcta tgtgactcat       360
     cagctcaatg aacagtggtt tttaggtctg gccttgggca gtaactttgg tatggcgact       420
     gagttggatg acagcttccg tggtactcag tttggtaatg aagcttctgt tactaccata       480
     gagatcaatc caaatatcgc atatcgcatc aatgagcagt tcagtgtcgg tgcaggtgtt       540
     cgtttcgtta ttggtgaagg tagcataggg gcaaagagtt cggccgattc tgttttaccg       600
     acgcctatgg gaaacctgcc ggtacctaaa gggaccacgc tgaaatacat ggaaggcgat       660
     gatacgtctt ggggctggca attaggtgcc gcctggcaga ttaacgatag taaccgtatt       720
     ggggtgaact accgctctgc cgtcgatcaa aatctggaag gtgaggccaa cggtttagcc       780
     ttcaacccaa tggatccaac attgaagatg gatggcgcca tggagttatc tctgccagcg       840
     accgcagagc ttgcttcttt ccatcagctg actgagaagt tggctattca tgccagcatc       900
     aactggaccg attggagctc atttgaaaag ttggaagccg ttattcctgc cctatctgag       960
     cctactcagc tagtgaagca ggaaaactgg aaagacagct atcgcttcgc tttaggtacc      1020
     acttatgatt tgagccaaaa atcgacccta cgcgcgggtg tggcttatga tagatctgcg      1080
     gtctctgacg ccaaccgtac cctgactatt ccagagatgg atcgtctgtg gctgagtgcc      1140
     ggttatggtt atcactatag cgataatctc gacctggact tcggtgtgac atacatcttt      1200
     gccgatgagt cacctgtggt tgagcctcgc cctgggattg agtctgatcg ttcttctgca      1260
     ctatttggcg gcacattcag tggtactact agtggcaata ttatgctggt gggcgtacag      1320
     gcaagctacc gcttctaa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page